KEGG   Maribacter sp. HTCC2170: FB2170_10449Help
Entry
FB2170_10449      CDS       T01306                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00052  Galactose metabolism
fbc00511  Other glycan degradation
fbc00600  Sphingolipid metabolism
fbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FB2170_10449
  Lipid metabolism
   00600 Sphingolipid metabolism
    FB2170_10449
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FB2170_10449
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FB2170_10449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N DUF4981 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: EAQ99726
UniProt: A4AWK8
Position
2633804..2637022
Genome map
AA seq 1072 aa AA seqDB search
MIMNKSFVFVLMSILLISCGKTVVKPEYTADKWENPDWENPEIFQINREEPTASFYRYAD
ESTALKNQSWENSPLYKSLNGTWDFYYADNPQKRPVEFYQDDFDLTGWDELDVPSNWEIQ
GHGIPFYTNVTYMFPPNPPYIPHEENPVGSYRRNFEIPESWDGKEIYLHFEGISGAAYVW
VNGEKVGYNEGSKTPAAFSITKNVKKGINTVAVQVLRWSDASYLEDQDFWRLSGIDRDVY
LYATNKTTIKDFTVVADLENEYSDGLLNLQIEINNAGDDLVDKVEITLSDGGEEIYSDSS
ILTNTVGTSEVVFEKKLPKIKTWNAEAPNLYTLLISLKSKDGSVTEATSVKVGFRKVEIK
NNQFLVNGKAVLLKGANLHDHNEHTGHVVTEELTLLDLKVMKQNNLNAIRCSHYPKNPHF
YRMCDQYGFYVIDEANIEIHGMGATNQGLDENLEAQKVHPAYLPEWKEMHLDRTVRMFER
DKNYTSIVTWSLGNEAGNGDNFRATYEWLKAHDSTRPTQYEGATQYENTDIQAPMYMRIP
DMINYAENNPERPLIQCEYAHAMGNSVGNLQEYWDVIEKYDVLQGGFIWDWVDQGILSKN
EAGEEYWAYGGDLGGEDYQNDVNFCLNGVVNPDRSAHPSLHEVKKVYQYIKFNAVNAKRG
EFAIKNIYDFTNLNQFEFSWKLFENGEETATGILPEMNVEPQTTEKVKIEYPDFKSTDGE
SFLNIYAKTKGETILLPKDHTIAYEQFKLSEFRPETFTKNNTGKGFEISTENNLVKIKGN
GFEVQFDTEKGDISSIDYGNGNILLRGVRANFWRASIDNDFGYNMPKRMKVWNEASNNQK
LQNLELDSGANNKTIEELKMAQNPFKVENDLVKLTTNFNLPDVNGSVGISYEINDKGEIR
ITTDLEGISHELPVLPRFGNNLIIKNEYQNVNWYGRGPHENYQDRKTSALVGNYDAKVED
LYFPYIRPQENGTRVDVRKLRFVNETGAGIEIFAPELFEFSAHHQYNSDFDPGETKQQRH
DVDIVKRDLVNINIDYKQMGVGGDNSWGFMALDKYQIQPENLSYSYIIRPLK
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaataaatcctttgtatttgtattaatgtcaatcttacttatctcttgtggg
aagacagttgtgaaacctgaatatacagcggacaaatgggaaaatcctgattgggaaaat
cctgaaatattccaaataaatcgtgaggaaccaacagcttctttttataggtatgcagat
gagtcaacagctttgaaaaatcaaagttgggagaattcaccattgtataaatctttaaat
ggaacatgggatttttactatgcggacaaccctcaaaaacgccctgttgaattctatcag
gatgattttgatttaaccggttgggatgaattggatgttccatcaaattgggaaattcaa
gggcatggcataccattctacacgaacgtcacctatatgtttcctccaaaccctccatat
attcctcatgaagaaaaccctgtagggagctatagaagaaattttgagattccagagagt
tgggatggtaaggaaatataccttcattttgaaggaatcagcggtgctgcatacgtttgg
gtaaatggagaaaaagttggttataatgaaggaagtaaaacacctgcggcattctcaatt
accaagaatgtaaaaaagggaattaatactgttgctgtgcaagttctacgttggtctgat
gccagttatttggaagatcaggacttttggagactgagcggaattgatcgcgatgtttac
ctatatgcgactaataaaacaacaatcaaggattttaccgttgttgctgaccttgaaaat
gaatacagtgatggattattgaacctacaaatagagattaacaatgcaggcgatgatttg
gttgataaagttgaaattaccttgagtgatggtggggaggaaatatattcggattcaagt
atactaactaatacagtaggaacttctgaagtggttttcgaaaagaaactgccaaaaata
aagacatggaatgcggaagcacctaacctatatacccttttgattagccttaaatccaaa
gatggttctgtcacagaggctacaagcgtaaaagttggctttagaaaggtagagatcaag
aataaccaatttctggtaaatgggaaagccgttttattgaaaggcgccaatttacatgat
cataacgaacatacaggacatgtggtcacagaagaacttacccttttggaccttaaggtc
atgaaacagaacaatctgaatgctattcgatgtagtcattaccccaagaacccacatttt
tatagaatgtgcgatcagtatggtttttatgttattgacgaggcgaatatcgagattcat
ggtatgggagcaacaaaccaagggctggatgaaaatttagaggcacagaaagtacatccg
gcttatttacctgaatggaaagaaatgcatttagatcgcacagtcaggatgtttgaacgc
gacaagaattatactagtatagttacttggtccttggggaatgaagcgggtaatggtgat
aattttcgtgcaacttatgaatggctaaaagcgcatgacagcacacggccaacacagtat
gaaggggcaacacaatatgagaatacagatattcaggcacctatgtatatgcgtattcca
gatatgattaattatgcagagaataatcctgaacgtcctctcattcaatgtgagtacgcc
catgcaatgggtaatagtgttggtaaccttcaagaatattgggatgtcattgagaaatat
gatgtactgcaaggtggttttatttgggattgggtggatcagggaattctctcaaagaat
gaagctggtgaagaatattgggcttatggcggggatttaggtggtgaggactaccaaaat
gatgtgaatttttgtttgaatggcgttgtgaatcctgatagatcagcacacccgtcttta
catgaggtaaaaaaagtataccagtacatcaaattcaatgctgtaaatgccaagagaggg
gaatttgcaataaaaaatatctatgatttcacaaatttaaatcagtttgaatttagttgg
aaattgtttgaaaatggtgaagaaacagcaacaggaatacttcctgaaatgaatgtagaa
cctcaaactaccgaaaaagtcaaaattgaatatcctgattttaaatctacggatggtgag
agtttcttgaacatttatgcaaaaactaaaggcgaaaccatattgctaccaaaggaccat
actattgcttatgaacagtttaagctttctgagttcagaccagaaacattcaccaaaaat
aatactggaaaaggatttgaaatttctacagaaaacaacttagtcaaaataaaaggaaat
ggatttgaagttcaatttgatacggaaaaaggcgatataagttcaattgactatggtaac
ggcaatattcttttgagaggtgtccgggctaatttctggagggcctccatcgataatgac
tttgggtataatatgccaaaaaggatgaaagtatggaatgaggctagcaacaatcaaaaa
ttacaaaaccttgaattggattctggagcaaacaacaaaaccattgaagaattgaaaatg
gcccaaaatccgttcaaagttgagaatgatttagtcaaattaactacgaatttcaatctt
cctgatgtaaatggtagtgttggaattagctacgaaataaatgacaagggtgaaataaga
ataacgacggatttagaaggcatttcacatgaattgcctgtgctaccgcgatttggtaat
aatttgattatcaagaatgaatatcaaaatgtaaactggtatggtcgtggaccacatgaa
aattaccaagatcgtaaaacatctgcactagtaggcaattatgatgcgaaagtggaggat
ttgtactttccctatattcgacctcaagaaaatggtactcgagttgatgttcgtaagctg
aggtttgtgaatgaaactggagcaggaattgaaatatttgcgcccgaattatttgaattt
agcgcacatcatcagtataattcagattttgaccccggtgaaaccaaacaacagcgacat
gatgtagatatcgtaaaaagagatttggtgaacatcaacatagactataaacaaatggga
gttggtggtgataatagttggggatttatggcattggataaataccaaattcaacccgaa
aatttatcctatagctatataattagacctttaaaataa

DBGET integrated database retrieval system