KEGG   Maribacter sp. HTCC2170: FB2170_10696Help
Entry
FB2170_10696      CDS       T01306                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FB2170_10696
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FB2170_10696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2706041..2706640
Genome map
AA seq 199 aa AA seqDB search
MKSYKSLEEYNLEITNDVKDRYSKIIEEIGEDVSREGLVKTPERAAKAMLFLTQGYQQDA
AEILKSAMFQESYNEMVIVKDIELYSLCEHHMLPFFGKAHIAYIPNGQIVGLSKLPRIVD
VFARRLQVQERLTEQILDCINDTLKPQGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGN
FEKEETRNEFLKLISSSLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatataaaagtttagaggaatacaatttggaaataacaaacgatgttaaagac
aggtattcaaaaattattgaagaaataggggaagatgtttcacgtgaaggtttggtgaaa
actcctgaacgtgctgcaaaagcaatgcttttccttacccaaggttatcaacaagacgct
gccgaaattttgaaaagtgcgatgtttcaagaatcttacaatgaaatggtcattgtaaag
gatattgagctgtattcgctttgtgagcaccacatgcttcccttttttggaaaagcgcat
atagcttacattcctaacgggcagattgttggattaagcaaattacccagaattgttgat
gtttttgctcgaaggttacaggtacaagaacgattgactgagcagatattggattgtata
aatgataccttaaaaccacaaggtgttgcagttgttattgaagctgcgcatatgtgtatg
atgatgcgaggagttcagaaacagaattctgtaactacaacttcgggatttaggggtaat
tttgaaaaggaggaaacaagaaatgaatttttgaaattgataagttccagtctgtcctaa

DBGET integrated database retrieval system