KEGG   Maribacter sp. HTCC2170: FB2170_10696Help
Entry
FB2170_10696      CDS       T01306                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fbc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2706041..2706640
Genome map
AA seq 199 aa AA seqDB search
MKSYKSLEEYNLEITNDVKDRYSKIIEEIGEDVSREGLVKTPERAAKAMLFLTQGYQQDA
AEILKSAMFQESYNEMVIVKDIELYSLCEHHMLPFFGKAHIAYIPNGQIVGLSKLPRIVD
VFARRLQVQERLTEQILDCINDTLKPQGVAVVIEAAHMCMMMRGVQKQNSVTTTSGFRGN
FEKEETRNEFLKLISSSLS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcatataaaagtttagaggaatacaatttggaaataacaaacgatgttaaagac
aggtattcaaaaattattgaagaaataggggaagatgtttcacgtgaaggtttggtgaaa
actcctgaacgtgctgcaaaagcaatgcttttccttacccaaggttatcaacaagacgct
gccgaaattttgaaaagtgcgatgtttcaagaatcttacaatgaaatggtcattgtaaag
gatattgagctgtattcgctttgtgagcaccacatgcttcccttttttggaaaagcgcat
atagcttacattcctaacgggcagattgttggattaagcaaattacccagaattgttgat
gtttttgctcgaaggttacaggtacaagaacgattgactgagcagatattggattgtata
aatgataccttaaaaccacaaggtgttgcagttgttattgaagctgcgcatatgtgtatg
atgatgcgaggagttcagaaacagaattctgtaactacaacttcgggatttaggggtaat
tttgaaaaggaggaaacaagaaatgaatttttgaaattgataagttccagtctgtcctaa

DBGET integrated database retrieval system