KEGG   Maribacter sp. HTCC2170: FB2170_10921Help
Entry
FB2170_10921      CDS       T01306                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_10921
  Amino acid metabolism
   00340 Histidine metabolism
    FB2170_10921
Enzymes [BR:fbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     FB2170_10921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2747897..2749180
Genome map
AA seq 427 aa AA seqDB search
MNKIFNPEKKDWSQVLKRPTQTVSDIEDVVNEVFAKVEKEGDPVLKQYTQKFDGVTLKSL
QVSEVEISEAANRIGQELKNAIAIAKKNIETFHKAQETNKVEVETTKGVFCWQEKRPIQK
VGLYIPGGSAPLFSTILMLAVPANIAGCTEIVLCTPPNKEGKVHPAILYTANLCGVTQIF
KVGGIQAIAGMTFGTESISKVYKIFGPGNQYVTVAKQIATKYGISIDMPAGPSELLVMAD
DSANASFVASDLLSQAEHGADSQVILVSTSKAMIHAVEEEVEKQLEKLPRKAIAEKAIEN
SKLVFVTDSQSAIDLINEYGPEHYILCVEDEEIYLTQIMNAGSVFIGNYTPESAGDYASG
TNHTLPTNGYAKQYSGVNLDSFKKSMTFQKINTEGIKEIGRAIELMAEAEGLQAHKNAVT
LRLESLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatattcaatccagaaaagaaagattggagtcaagtactcaaacgtcctact
cagacggtttcagatattgaggatgttgttaatgaggtctttgccaaggttgaaaaagaa
ggcgacccagtacttaaacaatatacccagaagtttgatggtgtaacattgaaaagttta
caagtatctgaagttgaaatttcagaagctgcaaatcgtattggtcaagaactaaaaaat
gcaatagccatagccaaaaagaatattgaaacttttcacaaggcccaagaaacaaataaa
gttgaggttgaaacaactaaaggcgttttttgttggcaagagaaaagacctatacaaaag
gtggggttatatattccaggaggttcagcacctttgttttctacaattttaatgttagct
gtaccggctaatattgctggttgtacagagattgtattatgtactccacctaataaggaa
ggaaaagttcatccagctattttgtatacggccaatttgtgtggggttacacaaattttc
aaagtaggagggattcaggcaatagcgggaatgacttttggaacggaaagtatttctaaa
gtgtacaagatttttggccctggaaatcaatacgtaacagtcgcaaaacaaattgcgact
aagtatgggatatctattgatatgccagccggccccagtgaattattggtcatggcagat
gatagtgccaatgcttcttttgttgcttcagatttgttgagtcaggctgaacatggggct
gatagccaagttattttggtttctacttcaaaagcgatgattcatgccgttgaggaagaa
gttgaaaaacaactagaaaaattgcctagaaaagcaattgctgagaaggccattgaaaat
agcaaattagtatttgttaccgattcacagtcagctattgatttaattaatgaatatggt
cctgagcattatatcctgtgtgttgaagacgaagaaatatacttaactcaaataatgaac
gcaggttctgtgttcattggaaattacactcctgaaagtgccggggattatgcatcggga
accaaccataccttacctacaaatggctatgccaaacagtatagtggggtaaaccttgat
agttttaaaaaaagtatgacctttcaaaaaataaacacagaaggaataaaggaaattggt
agagccattgagttgatggctgaagcggaagggcttcaggcgcacaaaaatgcagttaca
ctacgattggaaagtttaaaataa

DBGET integrated database retrieval system