KEGG   Maribacter sp. HTCC2170: FB2170_11151Help
Entry
FB2170_11151      CDS       T01306                                 

Definition
Magnesium chelatase subunit ChlI family protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FB2170_11151
Enzymes [BR:fbc01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     FB2170_11151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2785799..2787268
Genome map
AA seq 489 aa AA seqDB search
MNLDIKKINTLGALKKAGYQSKSIKDELRTNLISNIRDGVATFEGVWGYENSVIPELERA
ILSRHNINLLGLRGQAKTRLARLMVGLLDEFIPIVQGSEINDDPLKPISRYAKELIKEKG
DKTPISWLPRTDRFYEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANR
CIFVINELPDLQSRIQVSLFNILEEGDIQIRGFKLRLPLDLQFVFTANPEDYTNRGSIVT
PLKDRIGSQILTHYPDDISTAKKITEQESNLDNRQIEGVYVPEIAKDLLEQISFEARDSE
YVDVKSGVSARTSITAFENLLSTAERRTLLSGADSTTVRLSDFIGVIPAITGKIELVYEG
EQEGADIVASILIDEAVKSIFPQYFPKIDKLERKDAESPYDELTSWFFQSEGFELEDEYT
DAEYKRALDDIPPLNQLIKTFQPDVSKTDSYFLKELLLWGLVAYKKLSKHRFSEGYQFKD
LYGSYINDL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatttggatataaaaaagataaacactttgggagcgcttaaaaaagcaggctatcaa
agtaaaagtataaaagatgagttacgcactaacctaatttcgaatattagggatggcgta
gcaacctttgaaggggtttggggctatgaaaattcggttattcctgaattggaacgtgcc
atcctttcacgacataatattaatctgttgggtttacgaggacaagcaaaaacccgattg
gcgcgattgatggttggtttgttggatgaattcattccaattgtccaaggctctgaaatc
aatgatgatcccttaaaacctatttcgaggtatgccaaggaattgataaaggaaaaagga
gataaaaccccgatatcgtggctgcctcgaacggaccgtttttatgaaaaactggctact
ccggatgtaactgttgctgatttaataggcgatgtagaccctataaaagcagccaatcta
aagctatcctatgctgatgaccgagtgatacattttgggatgatcccacgtgccaatcgc
tgtatattcgtaatcaatgaattgcctgatttacaatctcgaatacaagtatccttattc
aatatcctggaagagggtgatattcaaattcgtggattcaaattgcggttgccattggat
ttacagttcgtatttacagcaaatccggaggattacacgaataggggaagtattgtaacg
ccattgaaagatagaattggttctcagattttaacgcattatccagatgatatttcaaca
gccaagaagataaccgaacaagaatcaaatttggataatcgacagattgaaggtgtttat
gttcctgaaattgccaaggatttattagagcaaataagttttgaagcccgtgatagtgaa
tatgtagatgttaaaagtggtgttagtgcacgaacaagtataactgcttttgagaatctg
ctaagtacggcggaacgcaggacattactttcaggagctgatagcacaacggttaggcta
agcgattttattggcgttattcctgcaataacaggaaagattgaattggtatatgaagga
gagcaggagggggcagatattgttgcatctattctaattgatgaagctgtaaaatctatc
tttccacaatactttcctaaaatagataaattggaacgcaaggacgccgagagtccgtat
gatgaattgacctcttggttttttcaaagtgaaggatttgaattggaagacgagtatact
gatgctgaatataaaagggctttggatgatattccacctttaaatcaattgattaaaacg
tttcagccagatgtttcaaaaacagacagttactttttaaaagagttgttgttatggggt
cttgtcgcttataaaaaattgagcaaacatcggttttcggaaggataccaatttaaagat
ctttacggtagttatatcaacgatctataa

DBGET integrated database retrieval system