KEGG   Maribacter sp. HTCC2170: FB2170_11386Help
Entry
FB2170_11386      CDS       T01306                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FB2170_11386
  Lipid metabolism
   00600 Sphingolipid metabolism
    FB2170_11386
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FB2170_11386
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     FB2170_11386
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2832316..2835666)
Genome map
AA seq 1116 aa AA seqDB search
MTNQKRLFYLFFTASILSVSLNGQQKDPISDYQYFIENEQVIGDNKLDAHASFTSYTSSK
VLEAGKPQFHKSLNGIWKFNWVRNPKERPTGFMNTGFDTSEWDDIKVPSNWEVEGFGIPI
YVNHQYEFADYKAPVAEDMEIIDRVYPKNPGNVPDNYNPVGTYVREFTVGKDWKDKESFL
HIGAMKSGGFVWINGKYIGYSQGSKLPAEFNISKALKSGKNSIALQIFRWTDGSYLECQD
FWRISGIERDVFIYAQPKVRINDFEVTSVLDGSYTKGEFSLDVDLENHLSKNKEVSLSYK
IWDNNNDLASDSETLQLKKSVKSTFSFKATIPTVKPWSAEHPNLYTLILETKDKKGNLIE
TTTRKIGFRSVEIKNGLLLVNGQRITLKGVNAQETDPETGHIMSEEMILKDIRLWKENNI
NAVRLSHYPRGRRFYELCDLHGMYVVDEANIESHGMYYGKYSLAKKPDWEKAHVDRMVRM
VERDKNHPSVIIWSMGNEAGNGVNFFKAYDAIKANDITKRPVQYERPYKEHDGNLFDMDS
NTDIIVPQYPSPARFREIGTSMTDRPFIPSEYAHAMGNSTGNFQDYWDIIELYDNLQGGF
IWDWVDQSIWKTNENGERFYAYGGDYGENMPTDNSFLNNGIVFPDRSPQPGLYEVKKAHE
FINFKEKGINRSNELRVLIENLYDFTNLDQFNFTAQIKADGKALKTIPIDNIAIETHTGR
LIRIPLTDIDFKANTEYFVEISATTINDWGLLPEGFEVAHEQIALAGKFKKEANPKLEEK
ALSLTESNGKIIIDNDQLKLVFNKKEGRLTSYVFQGEELLKDGKGPKPNFWRAPTDNDFG
NQMHIKNLEWKKASLFSKVSKVTHIIMKDGSVQFEVTYQLPGVETSFTSVYTVYGNGVVA
MENTLNSTEYMADVPRIGMRMQLPKQYDAMNYFGRGPWENYQDRRASAFVDLYTSEVKDQ
YVPYIRPQENGYKTNVRWAAFSNQKNKGLLIVAKNPQKGLGISALHMPNEDFDTTAGLDY
GGNKKVNKTYQIDGIPEVNGSKHTTDIKEQDLVQLNIDMEQRGVAGDDSWYAKPQEKYMI
KGQQNHSYGFFMIPFNSGSPQEFINLGKLYGNLKSK
NT seq 3351 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatcaaaaaagactcttttacttattctttaccgcttccatactttcagtttca
ttgaatggacaacaaaaagacccaatttccgattaccaatattttattgaaaatgaacaa
gtgatcggtgataacaaattggatgcccatgcatccttcacctcctatacttcttcaaaa
gtgttggaagctggcaaacctcaattccataaatcattgaacggaatctggaagttcaat
tgggtaagaaatcctaaggaacgcccaaccggttttatgaacacagggttcgacacatcc
gaatgggatgacatcaaagttccttctaactgggaagttgaggggtttgggattccgatc
tatgtaaaccaccagtatgaatttgccgattataaggcacccgttgctgaagacatggaa
ataatcgacagggtctatccaaaaaaccctggtaatgttccagacaactacaatccggtc
ggcacctatgttagagaattcacagttgggaaagactggaaagacaaagaaagtttcctt
catatcggggccatgaaatctgggggatttgtctggattaatgggaaatacataggatac
tcccaggggagtaaactaccagctgagtttaatattagcaaagcgctgaaatctggaaag
aatagcattgcgctgcaaatttttaggtggacggacggttcttatctcgaatgtcaggat
ttttggcgcataagtggtattgaacgtgatgtgttcatctatgcgcagcccaaagttaga
atcaatgattttgaagtgacttcagttttggatggttcatataccaagggtgaattctca
cttgatgttgatttggagaaccatctttccaaaaacaaggaagtttcgctatcctataaa
atttgggataataacaacgaccttgcatcagacagcgaaacgcttcaacttaaaaaatca
gtgaaatcaacattttcttttaaggcaacaattccaacagtaaagccatggagtgccgaa
catccgaatctatataccttgattctggaaaccaaagataaaaagggcaatctcattgaa
acaacaacgaggaaaatcggttttcgctctgtagagataaaaaacggactcctgttggtg
aacgggcaacgtataaccttaaaaggtgtgaatgcacaggaaacggatccagaaacaggg
catattatgtctgaggaaatgatactgaaagatattcgcctatggaaagaaaacaatata
aacgcagtacgcttaagccattaccccagaggtagacgtttttacgagctttgtgacctt
cacggtatgtacgtggtcgatgaggcgaatattgaatcacacggaatgtattatggtaaa
tattcactggcgaaaaaaccagattgggagaaagcccatgtagaccgaatggtcagaatg
gttgaacgcgacaaaaaccacccttcggtcataatatggtcaatgggcaatgaggctggc
aatggcgtaaatttctttaaagcctatgatgcgattaaggccaatgacattaccaaacgc
cctgtacaatacgagcgtccatataaagaacatgacggtaatttattcgatatggacagt
aatacagatattattgtacctcaataccccagccctgcacgtttcagagaaattgggacc
tctatgacagaccggccatttattcccagtgaatatgcccacgctatgggtaacagcaca
ggaaactttcaagattattgggatatcattgaactttacgataatctccaaggtggcttt
atttgggactgggttgaccaatccatttggaaaaccaatgaaaatggggaacgtttctat
gcctatggtggggattatggcgagaacatgcctacggacaattcctttctgaacaatgga
attgtttttcctgaccgttcgccgcaaccaggtctatacgaagtaaaaaaggcccatgag
ttcatcaattttaaggaaaagggaattaacaggagtaatgagttacgggtacttattgag
aacctttacgatttcaccaatctggaccaattcaactttacagcccagataaaagctgat
ggcaaagccttaaaaaccattcctattgataatatagctatagaaacacataccggaagg
ctcattcgcattcccttaacagatattgattttaaggccaatacagagtattttgttgaa
atttccgcgaccacaataaatgattggggcttgttgcctgaaggctttgaggttgcccat
gagcaaattgccttggcaggtaaattcaaaaaagaagcaaaccccaaacttgaggaaaag
gccttgtccctaaccgaatccaacggaaaaataattattgacaacgaccaattgaaattg
gtgttcaataagaaagaaggccgtctaacttcctatgtttttcaaggtgaagagctttta
aaagatggtaaaggtcccaagcccaacttttggcgtgcccctaccgataatgattttggt
aaccaaatgcacattaaaaacctggaatggaaaaaagcatcgctcttttcaaaagtatcc
aaggtcacgcatatcataatgaaagacggtagcgtacagtttgaagttacttaccaacta
ccaggggtagaaacctcatttacatcggtttacacggtgtatggtaatggagtggtagcc
atggaaaacaccttgaacagtaccgagtatatggcagatgtcccccgtattggtatgcgc
atgcaattacccaaacagtatgatgccatgaactattttggtcgtggcccttgggagaat
taccaagaccgaagagcctcggcctttgttgatctttatacctcagaagtgaaagaccag
tatgtgccctatattcggccacaagaaaacggatacaagaccaatgtccgttgggccgcc
ttttccaaccaaaagaataaaggcttgctcatcgttgctaaaaatccacaaaaaggttta
ggtattagtgccctacatatgcccaatgaggactttgataccactgcgggattggactac
ggtggaaataaaaaagtaaacaaaacttatcaaatagatggcatacccgaggttaacgga
agtaagcataccacagatatcaaggagcaggatttggtgcaattaaatattgacatggaa
caacgcggcgttgccggtgatgacagttggtacgccaaaccccaggaaaaatacatgatt
aaagggcagcaaaatcattcctacggattcttcatgattccttttaacagtggatctcct
caagaatttattaatcttggaaaactatatggtaatctaaaaagcaaataa

DBGET integrated database retrieval system