KEGG   Maribacter sp. HTCC2170: FB2170_11716Help
Entry
FB2170_11716      CDS       T01306                                 

Definition
alpha-galactosidase/6-phospho-beta-glucosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    FB2170_11716
  Lipid metabolism
   00561 Glycerolipid metabolism
    FB2170_11716
   00600 Sphingolipid metabolism
    FB2170_11716
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     FB2170_11716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2904092..2905465
Genome map
AA seq 457 aa AA seqDB search
MIKIAYIGAGSLQFGPLIVQDILMSNSLSQNGLEIHLMDIEKSHLEHVIKHGEYVNKKLG
RSAKIIATTNRDEAIKDADFVICALEKDRNIYWSQDFHIPRKYGFEQVYGENGGVGSLFH
ALRNIKVIMDLARKMEELCPHAMLLNFSNPEHKICEAVTRLTSIKTVGLCHGVFMGREQL
SKLLGVPLTDLQTKACGINHFTWFQEIIQKSTGEDLYPKLKEIEQKGDWLANWHELALGR
ILFRRFGQWPSPASNHYGEYLRWAGEFVIPQLQFFYDPYDGHPWENNQIPEGVYTVDRVD
YEREWSKDWSKKLLPVGSTEEIQLENEDGSFKSSGEIATLIMESVVTDKKEWLEAVNVPN
KGAIPNLPDDLVVEVPAYGDTSGIHPVQMKPIPEGIAATIRLHASIHQLLVEAYNEQSKD
KLLQAILIEPTVNSYRNAVDMCNEMLTLQEDVLPQLK
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattgcatatataggtgctggcagcctacaatttggccctttgatagtacaa
gatatactaatgagcaattcgctatcgcaaaatggattggaaatccatttaatggatatt
gaaaaatcacatctggaacatgtaataaaacatggtgaatatgtaaataaaaagctgggg
cgtagtgccaaaataattgctactacaaatagagatgaagctatcaaggatgccgatttt
gtgatttgtgcccttgaaaaggaccgtaatatttattggtcgcaagattttcatattcca
agaaagtatggctttgagcaagtgtacggtgaaaatgggggagtggggtccctctttcat
gcactgcgaaacatcaaggttataatggatttggccaggaaaatggaagaactatgcccc
catgccatgttactcaacttttctaaccccgaacataaaatttgtgaagcagtaacacgc
ttgacttccattaaaacagttgggttgtgccatggtgtttttatggggagggagcaatta
tccaaactacttggggtgcctttaaccgatttgcagaccaaagcctgcggtattaatcat
tttacttggtttcaagaaataatacagaaatcaacaggcgaggatttataccccaaatta
aaggaaattgaacaaaaaggagattggcttgccaattggcatgaacttgccctagggagg
attttgtttagaagatttgggcaatggccttcacctgcctccaaccattatggcgaatac
ctaagatgggcgggagaatttgtgataccgcaattacagttcttttatgacccttatgat
ggtcacccgtgggagaacaaccaaattccagaaggagtgtacaccgttgaccgtgttgat
tatgaaagggaatggtccaaagactggagcaaaaaactattacctgtaggatcaactgaa
gagatacaattggaaaatgaggatggaagttttaaaagctctggtgaaattgctacgttg
attatggaatctgtagtaaccgataaaaaagagtggttagaagcggttaacgtacccaac
aagggtgcaattcccaatttaccggatgatttggtggttgaagtacccgcttatggcgat
acttccggtatccacccagtgcaaatgaaacctattccagagggtattgctgcgaccatt
cgtttgcacgcaagcattcatcaacttttggttgaagcgtacaatgaacagtccaaagat
aaactcctacaggccattttaattgagccaacggtaaattcttatcgcaatgctgtggat
atgtgtaacgaaatgctgaccttacaagaagatgtcttgccccaacttaaataa

DBGET integrated database retrieval system