KEGG   Maribacter sp. HTCC2170: FB2170_12316Help
Entry
FB2170_12316      CDS       T01306                                 

Definition
di-haem cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fbc  Maribacter sp. HTCC2170
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3043768..3044955
Genome map
AA seq 395 aa AA seqDB search
MIKKNIIKSSLYGVALFVMILILYSGNVSSSYSAIPLLNSKCPPGFKLNENNQCISKNLY
NQYAVTNDAGVGGLKSALPEIRDGFSPQEIDLGRYLFFDPVLSADQTVSCATCHDPNKGL
SDGLAVSEGINDHILKRGAPSLWNVGYLKKLFWDGRAVTLEEQMQGPLFSEEEMGNTPEN
LIRTINGIENYRKLFAEAFDNRNGNDPIELTEILRAITAFQSSLVSLNSKYDQYAHGYHG
ALNQNEIEGLNVFRSFVARCAECHTPPLFTNQQFAVIGTPEPDGLPLDPGAEFPFNDKSL
RGAFKVPSLRNIAKTAPYMHSGRFKTLRETVQFYTDGRGHAVPEGENLLIHWHIWEPNLT
DYELDRLVDFLGTLTDESFTPKVPTELPSGLKASI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaaaacatcataaaatctagcttatatggagttgcattatttgtgatgata
ttgattctttattcaggtaacgtgtcttcatcttattcagccatacctcttttaaattcc
aaatgcccaccagggttcaaactgaatgagaacaaccagtgtatctcgaagaacttgtat
aatcaatatgctgtaacaaacgatgcaggcgttggtggtttaaaatctgctttaccggaa
atccgtgatggtttttctccccaagaaatagacctaggcagatatttgttttttgacccc
gttctttccgctgaccaaacagtttcatgtgccacttgccatgaccctaataaaggctta
agtgacggattagccgttagtgaaggtataaacgatcatatactaaaaagaggagcccca
tccctttggaatgtcggttaccttaagaaactattttgggatggccgggcagtgaccttg
gaagaacaaatgcaaggaccccttttttctgaagaagaaatgggaaatacccctgaaaat
cttattaggaccattaacggaatcgaaaactatcgaaaactattcgcagaagcttttgac
aatagaaatggaaatgaccctattgagcttactgaaattctaagagccataacagctttt
caatcgtcattggtgtcattgaacagtaaatacgatcaatatgctcatggctatcatggg
gcattaaatcaaaatgaaattgaaggattaaacgtttttaggtctttcgttgctaggtgt
gcggaatgccacacaccgccattattcactaaccagcaatttgccgttattggtaccccc
gaacctgacggcttacctttggacccaggtgcggagtttccttttaacgacaaatccttg
agaggagcgtttaaggttcccagcttaagaaatattgccaagacagcaccatatatgcac
tccggcagatttaaaacacttcgagaaacagtacaattttatacagacggaagaggtcat
gccgtaccagaaggtgagaatctgctaattcattggcatatatgggaacctaatttaact
gactacgaattagatagattggtagattttctaggaaccttaacagacgaatcatttacg
cccaaggtgcctacagaattaccatctggattaaaagcatctatttaa

DBGET integrated database retrieval system