KEGG   Maribacter sp. HTCC2170: FB2170_13291Help
Entry
FB2170_13291      CDS       T01306                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fbc  Maribacter sp. HTCC2170
Brite
Enzymes [BR:fbc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     FB2170_13291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3254590..3255204)
Genome map
AA seq 204 aa AA seqDB search
MRNKLADVLIAKGIKDTRVLDAIRTVPRHLFMDSSFEGHAYQDKAFPIAADQTISQPYTV
AFQTELLKVEPGHKILEIGTGSGYQTAILLLLKAKVYTIERQQTLFKKTNLFFKKMGYRP
KKVIFGDGYKGLSEEAPFDSIIVTAGAPEVPKALMSQLKIGGRLVIPVGVEKQIMTLFIR
KSEKEFEKKELGAFRFVPLLEDKN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaacaaactggctgatgtgttgattgccaaaggaataaaagatacaagagtcttg
gatgcaatcaggacagtgcctcgtcacctttttatggatagcagttttgaaggtcacgcc
tatcaggacaaggcctttcccattgctgctgatcaaactatatcacaaccttatacggta
gcttttcaaactgaattgttaaaagttgagcctgggcataaaattctcgaaattggcaca
ggaagcggttaccaaaccgcgattcttttgttgttaaaggcaaaggtttatacgatagaa
agacaacagactctctttaaaaaaacaaatctatttttcaaaaaaatggggtatcgtcct
aagaaggtaatttttggtgatggttacaaaggtttgtcagaagaggccccttttgatagt
ataatagttacagctggtgcccctgaggtaccaaaagccctgatgtcgcagttaaaaata
ggtggaaggctagttattcctgttggtgttgaaaagcaaattatgacattgttcattcgt
aagtctgaaaaggaatttgagaaaaaagagttaggggcttttagatttgttccacttttg
gaggacaagaactag

DBGET integrated database retrieval system