KEGG   Maribacter sp. HTCC2170: FB2170_13933Help
Entry
FB2170_13933      CDS       T01306                                 

Definition
beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FB2170_13933
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    FB2170_13933
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     FB2170_13933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3376155..3377786
Genome map
AA seq 543 aa AA seqDB search
MRSILIILVTFIFASSCTEKNKTFLASEISIIPKPAELSLVEESFAFENGLKISVTGNEQ
NAAADFLINSLQQNANVSLVKSNSDSTSSIVFSNDTSLKVEAYKLNITPNQIKVSANSPS
GYFYGVQSILQLLTKDETSTEKWLVPSVVINDVPKFKWRGYMLDESRYFQGEEFVKLVLD
QMAYLKMNVFHWHLTDDGGWRMEIKKYPKLTEIGSHRVDSEIETWKSGKTSGEPHGGFYT
QEQIKDIVAYAAKRHITIVPEFEMPGHASSAIAAYTWLGTAGKDIDVPIKFGRHYDNYDI
TKPEVIQFVKDVLIEMFEMFPSEVIHIGGDEVGYKVWEDAKHVQNYMKQNGLQTPADLQV
NFTNEISKFIEQNGRRMMGWNEIMGKNIHQGFEEKKDDKDAETALAKNVVVHFWKGNLDL
ATEAAKKGYGIVNSLHSETYLDYAYDNITLEKAYSFNPIPDGLEEKYHKNVYGLGCQMWT
EWTPTTKDVVYQTFPRIAAYAEVGWTDDENKDFEVFKIRLKKLQQHWDKLNIAYAEFLDD
PVN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaatacttattattctggtaacttttatttttgccagtagttgtaccgaaaag
aacaagacatttttggcatctgaaatttcgataattccaaaaccagcagaattaagccta
gtagaagaatcattcgcatttgaaaatggccttaaaatatctgtaacaggtaatgaacaa
aatgcagctgccgattttctgattaacagtttacaacaaaatgccaatgtgagtcttgta
aaatcaaattctgattccacatcctcaattgtattttcaaatgatacaagcttgaaagtt
gaggcttataaattgaatataactccaaatcaaataaaggttagtgcaaatagtccttct
ggctatttttatggagttcagtccattcttcaattgttgaccaaggacgaaacctctaca
gagaaatggctagttccctccgtagtgattaatgatgttccaaagtttaaatggcgggga
tatatgctcgatgagtctagatatttccaaggggaggaatttgtaaagcttgtccttgat
cagatggcatacttaaagatgaatgtttttcattggcatttgaccgatgacggtggttgg
cgtatggaaataaaaaaatatccaaaattaacagaaattggttcgcatagggttgacagt
gaaattgaaacgtggaaaagtggaaagacctctggtgaaccgcacggtggcttttatacc
caagaacaaatcaaagatattgttgcatatgctgctaaaaggcatattacaatagtaccg
gaatttgaaatgcccggtcatgccagttcagccatcgctgcgtatacttggttaggtact
gcaggaaaggatattgatgttccaataaaatttggaagacattacgataactacgatata
accaaacctgaggttattcaattcgtaaaggacgtattgattgaaatgttcgaaatgttt
ccgtctgaagtaatacacattggaggagatgaagttggatataaagtttgggaagacgcc
aaacatgtacagaattacatgaaacagaatggattgcagactccagctgaccttcaggta
aatttcaccaatgaaatttctaaattcattgaacagaatggcagaagaatgatgggatgg
aatgaaatcatgggcaaaaatattcaccaaggatttgaagaaaaaaaagacgacaaagac
gcagaaaccgcattggctaaaaacgttgtagtgcatttttggaaaggaaatttagattta
gctaccgaagccgctaaaaaaggttatggtatcgtcaattctcttcatagcgagacatat
ttagattatgcctatgataacataactcttgaaaaagcgtacagttttaatccgattcca
gatggtttggaagaaaaatatcataagaatgtatacggtcttggttgccaaatgtggact
gaatggaccccaactacaaaagatgttgtctaccagacatttccaagaattgcggcctat
gcagaagttggatggaccgatgatgaaaataaggattttgaggttttcaaaattcgccta
aaaaaattacaacaacattgggacaaactgaatatagcatatgcagaattcttagatgac
ccagtaaattaa

DBGET integrated database retrieval system