KEGG   Maribacter sp. HTCC2170: FB2170_15128Help
Entry
FB2170_15128      CDS       T01306                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_15128
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_15128
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FB2170_15128
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FB2170_15128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3648299..3649594
Genome map
AA seq 431 aa AA seqDB search
MNFYSLNKKAPNVSFKDAVIKGIAPDKGLYFPESITPLSSSFFENIESLSNTEIAFEAIR
QFVYDEIPDDAIKAILKEVLDFEFPLVQIEENIATLELFHGPTMAFKDVGARFMAQCLGH
FSKSINNEVTVLVATSGDTGGAVANGFLGVAGVNVVILYPSGKVSDIQERQLTTLGNNIT
ALEVDGTFDDCQKMVKTAFIDTDLLDYMQLTSANSINVARWLPQLFYFLFAYKQVKAEYK
EIVFSVPSGNFGNICAGMVAQRLGMPVKHFVASTNVNDTVPEFMRTGTYHPKPSTATISN
AMDVGDPSNFIRIRHLFNDDFEALNKNLSSYSFTDFETKEAMKHIKQTSGYIADPHGAVG
YLGFKQYQKSHPNTFGIFLETAHPVKFLDVVEETINISPAIPPQIQKVIGKEKKSVKISE
YTELKQFLLNQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttacagtctaaataaaaaagcacctaacgtttctttcaaagatgctgttata
aaaggaatagctcctgataagggactttattttcctgaaagcattacccctttgtccagt
tctttttttgaaaatatagaatcgctctctaatactgaaatcgcatttgaagccattcgt
caattcgtttacgatgagattcccgatgatgctataaaagcaattctcaaagaggtattg
gattttgaatttcctcttgtccaaattgaggaaaatattgcgactctagaactctttcac
ggcccaacaatggccttcaaggatgttggagccagatttatggcccaatgtttaggccat
ttttcaaaaagtattaataatgaggttactgtgttggttgctacttcaggagatacaggt
ggggcagttgcgaatggttttcttggagttgccggggtgaacgtagtaattctatacccc
agtggaaaggtaagcgacatacaggaaagacagcttacaacgcttgggaacaatattaca
gccttggaggttgacggcacttttgacgattgccagaaaatggtaaaaacagcattcata
gatacggatttgcttgattatatgcagttgacttccgcaaactcaatcaatgttgctcgt
tggctaccccagttgttttattttctatttgcttacaagcaagtgaaggcagaatacaaa
gaaattgttttctccgtgccaagcggaaatttcggaaatatctgcgcaggaatggtagcc
caacgtttgggcatgcccgtaaaacactttgtagcctccaccaatgtaaatgatacggtt
cctgagtttatgaggactggaacatatcatccaaaaccctccaccgcaacaatttcaaat
gccatggatgttggtgacccaagtaattttattagaatcaggcatttgttcaatgatgat
tttgaagcacttaacaaaaatctcagctcttattcttttacagattttgagaccaaagaa
gccatgaaacatattaagcaaacatctggttatatagcggatcctcatggagctgtaggc
tatttgggtttcaaacaatatcaaaaatcccatccaaacacttttggtatctttttagaa
acggcccatcctgttaaatttttggatgttgtggaagaaacaatcaatatttccccagca
ataccgccccaaatacaaaaggttataggtaaggaaaaaaaatctgtcaaaatcagcgag
tatactgaacttaaacagttcttgctaaatcaataa

DBGET integrated database retrieval system