KEGG   Maribacter sp. HTCC2170: FB2170_15128Help
Entry
FB2170_15128      CDS       T01306                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fbc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fbc00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fbc00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3648299..3649594
Genome map
AA seq 431 aa AA seqDB search
MNFYSLNKKAPNVSFKDAVIKGIAPDKGLYFPESITPLSSSFFENIESLSNTEIAFEAIR
QFVYDEIPDDAIKAILKEVLDFEFPLVQIEENIATLELFHGPTMAFKDVGARFMAQCLGH
FSKSINNEVTVLVATSGDTGGAVANGFLGVAGVNVVILYPSGKVSDIQERQLTTLGNNIT
ALEVDGTFDDCQKMVKTAFIDTDLLDYMQLTSANSINVARWLPQLFYFLFAYKQVKAEYK
EIVFSVPSGNFGNICAGMVAQRLGMPVKHFVASTNVNDTVPEFMRTGTYHPKPSTATISN
AMDVGDPSNFIRIRHLFNDDFEALNKNLSSYSFTDFETKEAMKHIKQTSGYIADPHGAVG
YLGFKQYQKSHPNTFGIFLETAHPVKFLDVVEETINISPAIPPQIQKVIGKEKKSVKISE
YTELKQFLLNQ
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaacttttacagtctaaataaaaaagcacctaacgtttctttcaaagatgctgttata
aaaggaatagctcctgataagggactttattttcctgaaagcattacccctttgtccagt
tctttttttgaaaatatagaatcgctctctaatactgaaatcgcatttgaagccattcgt
caattcgtttacgatgagattcccgatgatgctataaaagcaattctcaaagaggtattg
gattttgaatttcctcttgtccaaattgaggaaaatattgcgactctagaactctttcac
ggcccaacaatggccttcaaggatgttggagccagatttatggcccaatgtttaggccat
ttttcaaaaagtattaataatgaggttactgtgttggttgctacttcaggagatacaggt
ggggcagttgcgaatggttttcttggagttgccggggtgaacgtagtaattctatacccc
agtggaaaggtaagcgacatacaggaaagacagcttacaacgcttgggaacaatattaca
gccttggaggttgacggcacttttgacgattgccagaaaatggtaaaaacagcattcata
gatacggatttgcttgattatatgcagttgacttccgcaaactcaatcaatgttgctcgt
tggctaccccagttgttttattttctatttgcttacaagcaagtgaaggcagaatacaaa
gaaattgttttctccgtgccaagcggaaatttcggaaatatctgcgcaggaatggtagcc
caacgtttgggcatgcccgtaaaacactttgtagcctccaccaatgtaaatgatacggtt
cctgagtttatgaggactggaacatatcatccaaaaccctccaccgcaacaatttcaaat
gccatggatgttggtgacccaagtaattttattagaatcaggcatttgttcaatgatgat
tttgaagcacttaacaaaaatctcagctcttattcttttacagattttgagaccaaagaa
gccatgaaacatattaagcaaacatctggttatatagcggatcctcatggagctgtaggc
tatttgggtttcaaacaatatcaaaaatcccatccaaacacttttggtatctttttagaa
acggcccatcctgttaaatttttggatgttgtggaagaaacaatcaatatttccccagca
ataccgccccaaatacaaaaggttataggtaaggaaaaaaaatctgtcaaaatcagcgag
tatactgaacttaaacagttcttgctaaatcaataa

DBGET integrated database retrieval system