KEGG   Maribacter sp. HTCC2170: FB2170_15238Help
Entry
FB2170_15238      CDS       T01306                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fbc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:fbc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3667426..3668352)
Genome map
AA seq 308 aa AA seqDB search
MSELSVKHLLGIKYLNEKDIQLIFETADHFKEVINRSIKKVPSLRDITIANIFFENSTRT
KLSFELAEKRLSADVINFSAGQSSVKKGETLIDTVNNILSMKVDMVVMRHPNPGAGIFLS
KHVNASIVNAGDGAHEHPTQALLDSFSIREKLGDVAGKKVVIVGDILHSRVALSNIFALK
LQGAEVKVCGPKTLIPKHVESLGVEVETNLRKALDWCDVANMLRIQNERLDISYFPTTRE
YTQQFGVNKALLDSLDKEIVIMHPGPINRGVEISSDVADSKQSIILNQVENGVAIRMAVI
YLLASKIK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactgagtgtaaaacacttactgggaattaaatatctaaatgaaaaagatatt
cagctcatttttgaaaccgccgatcattttaaagaagttatcaatcgttctataaaaaaa
gtgccttcattgcgtgatattacgatagccaacattttttttgaaaacagcactaggacc
aaactttcgtttgagttagccgagaaacgcttatcggcagatgtgattaatttttcagct
gggcaatcctctgttaagaaaggggaaacattgattgatacagtaaacaatattctctcc
atgaaggttgatatggttgtgatgcgtcaccctaatcctggagcaggaatatttctctca
aaacatgtaaatgcctctattgtaaatgctggggacggggcacatgaacacccaacacag
gctttattggattctttttccatacgtgagaaattaggtgatgttgcaggtaaaaaagtt
gtgattgttggtgatatattacattcacgtgtggctttgtcaaatatatttgccttaaaa
cttcaaggagccgaagtaaaagtatgtggacctaaaaccctgattccaaaacatgttgaa
tccctaggggtagaagttgaaacaaacttacggaaagctttggattggtgcgatgtcgcc
aatatgttgagaatccaaaatgaacggttggatatcagttattttccaacgacaagagag
tatacccagcaatttggagtaaataaagcccttcttgactccttggacaaagaaatcgta
atcatgcacccagggccaataaataggggagtagagattagtagtgatgttgcggactct
aagcaatccattattttgaaccaagtggaaaatggggtagcaattcgtatggccgttatc
tatttactcgcttcgaaaataaaataa

DBGET integrated database retrieval system