KEGG   Maribacter sp. HTCC2170: FB2170_15343Help
Entry
FB2170_15343      CDS       T01306                                 

Definition
glycogen branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FB2170_15343
Enzymes [BR:fbc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     FB2170_15343
Exosome [BR:fbc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FB2170_15343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3689022..3690917)
Genome map
AA seq 631 aa AA seqDB search
MSKVIVHSLFSEFDIDLFKSGKHFKLYEKLGSHPIEVDGKKGTYFAVWAPTAKSVSVVGD
FNGWQENEHQLNVRWDESGIWEGFIPEIGHGTLYKYSIHSNNFGIATEKADPFAKFCEHP
PKTASVVWEADYKWKDKKWMDTREDKNALDKPYSVYEVHLGSWKRNENGDFLSYKELSQD
LVKYVKDMGFTHVEFMPIMEYPYDPSWGYQLTGYFAPTSRFGDPEEFKLLVDKLHQNGIG
VILDWVPSHFPEDAHGLGFFDGSHLYEHPDRRKGYHPDWKSLIFNYGRNEVRAFLISNAL
FWLDQYHVDGLRVDAVASMLYLDYSREEGEWEPNMYGNNENLEAISFIRELNETVYGSFP
GVQTIAEESTSFSMVSKPVNMGGLGFGMKWMMGWMHDTLEYFKKEPIYRKHHQNDLTFSM
TYAFTENFMLPFSHDEVVYGKKSLLYRMPGDEWQQFANLRLLYGYMFTHPGTNLIFMGGE
FGQSSEWNYNQSLDWHLTQYDFHSGIQKLIKDLNKIYKTNPALYEKQFSQEGFQWIDYGD
GENSVLTYLRKGHQEENNIIVAANFTPVPRKNYRIGVPKTGALKEIFNSDAKKYGGSGAK
NSAVKTEKKSCHGFDDSIEITIPPLGIVIFQ
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagttattgttcattctcttttttctgagttcgatatcgatttatttaaatcg
ggaaagcattttaaattatatgaaaaacttggctcacaccctatcgaagtagatggaaaa
aaaggtacatacttcgctgtttgggcgcctacggcaaaatctgtttccgtggtaggtgat
tttaatggatggcaagaaaatgaacatcaactcaatgttcgttgggatgaaagtggtata
tgggaagggtttatcccagagattggccatggtacactatataagtattcaatacactcc
aataattttggtattgcaaccgaaaaggcagacccatttgccaaattttgtgaacatccc
ccaaaaacagcttcagtggtttgggaggccgattataaatggaaagacaaaaaatggatg
gatacaagggaagataaaaatgccttggataaaccctattccgtttacgaagttcattta
ggctcctggaaacgaaatgaaaatggcgatttcctatcttataaagagttatctcaagat
ttggtgaaatatgttaaggatatgggctttacgcatgtagaattcatgccgatcatggaa
tacccttatgatccttcttggggttatcagctaacaggatattttgccccaacatcgcgc
tttggggatcctgaggaatttaagttattggtagacaaattgcaccagaatggcattggg
gttatccttgattgggtgccttcacactttccggaagatgcacacggtttagggtttttt
gatgggtcacatttgtatgaacatcccgataggagaaagggatatcacccagattggaaa
agcttgatttttaattatggacgaaatgaggttcgtgcatttttgattagtaatgccctt
ttttggttggatcagtatcatgttgatggtttaagggtagatgcagtggcatcgatgctt
tatttggattactcaagagaggaaggggagtgggaacccaatatgtatggtaataatgaa
aacctagaggcaatttcatttataagggaattgaatgaaacggtatacggaagttttcca
ggtgttcagaccattgctgaagaatctacttcattttcaatggtgtcaaaaccggtgaat
atgggtggactaggttttgggatgaaatggatgatgggatggatgcacgatactctagag
tattttaagaaagaacccatctatagaaaacatcatcagaacgatcttacatttagcatg
acctacgcctttacagaaaactttatgcttccgttttcacatgacgaggtggtttatggt
aaaaaatctcttctatatagaatgcctggggacgagtggcagcaatttgcgaatttacga
ttgctgtacggttatatgttcacgcaccctggtacaaacctgatttttatggggggcgag
tttggacagagttctgaatggaattataaccaaagtctggattggcatttgacccagtat
gattttcattccggtattcaaaaactgatcaaagacctgaataagatttataagacaaat
cctgctctttatgagaagcagttcagtcaagaaggatttcaatggatagattacggagat
ggtgaaaattctgtattaacatacctaagaaaaggtcatcaagaggaaaacaatataata
gtagccgcgaattttactcctgtgccacgtaaaaactatagaattggagtaccgaaaact
ggtgcattaaaggaaatattcaacagcgacgccaaaaagtatggaggctctggggcaaag
aattctgccgttaaaacagaaaaaaaatcgtgtcatgggtttgatgattctattgagatt
accattccgcccttaggaattgttatttttcaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system