KEGG   Maribacter sp. HTCC2170: FB2170_15976Help
Entry
FB2170_15976      CDS       T01306                                 

Definition
(GenBank) lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00020  Citrate cycle (TCA cycle)
fbc00310  Lysine degradation
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
Module
fbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FB2170_15976
  Amino acid metabolism
   00310 Lysine degradation
    FB2170_15976
Enzymes [BR:fbc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     FB2170_15976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Glyco_hydro_57
Motif
Other DBs
NCBI-ProteinID: EAQ99835
UniProt: A4AW69
Position
complement(3830531..3831877)
Genome map
AA seq 448 aa AA seqDB search
MSKFELKLPRMGESVAEATLTTWLKEVGDTIEMDEAVFEIATDKVDSEVPSEVEGVLLER
LFEVDDVVKVGDTVAIIEMEGEATDEVDSTTEVEEIEVDDEIVAELTSTVEVAKEAIASA
PQDFGLSERFYSPLVRNIAKKEGISIAELDGIKGTGKDNRVSKNDILSYIAEKGNSVAPM
VATPAKKLESEISEPKIETPVEQKPVSTISATVGDEVIEMTRMGKLIAKHMVNSISTSAH
VQSFIEVDVTNIVNWRNKMKDSFFKTEGEKLTFTPIFMEAVAKALKKYPMMNISVDGDAV
IKKKNINIGMAAALPDGNLIVPVIKNADQLNLVGMAKVVNDLANRSRNNQLKPDEVQDGT
YTVTNVGTFGSVFGTPIINQPQVGILALGAIRKIPSVIETNEGDFIGIRSKMYISHSYDH
RVVNGALGSMFAKAVADYLEAWDINREV
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtttgaactcaaattgccacgtatgggagaaagtgttgcggaagcaacattg
actacttggttaaaagaagttggtgataccattgaaatggatgaagctgtttttgaaata
gccacagataaggttgattctgaggtcccgagtgaagttgaaggggttttgcttgaaagg
ctttttgaagttgatgatgttgtaaaggttggcgatacagtggccattatcgagatggaa
ggagaagccacagacgaggttgattcaaccactgaggttgaagaaattgaggttgatgat
gagatagttgccgagctaacttctactgtagaagtagcaaaggaggcaattgccagtgca
cctcaagattttggtctatccgaacggttttactcgcctctagtgaggaatatcgccaaa
aaagaaggaatttctatagctgagttggatggcataaaaggaacaggaaaagacaatagg
gtctctaagaacgatattttgtcatatatagcagagaagggtaattctgttgccccgatg
gttgcaactccagccaaaaagcttgagtctgaaatttccgaacctaaaattgaaacccct
gtagagcaaaaaccagtatccacgatatcagcaacagttggcgatgaggtgatagaaatg
accagaatgggcaaattaattgccaagcatatggtaaatagtatttctacctcggctcac
gttcaaagttttattgaggttgacgtaaccaatattgtgaattggagaaataagatgaag
gattctttctttaagactgagggagagaaattaacttttaccccaattttcatggaggcg
gtggctaaggctttgaaaaagtatcccatgatgaacatttcggttgatggggatgccgtt
attaaaaagaaaaacataaatataggaatggccgctgcattgcccgatggtaatttgatt
gttcctgttattaaaaatgcagatcaattaaacttggtcggaatggcaaaggttgtgaat
gatttggctaacaggtcaagaaacaatcagctgaaacctgatgaagtacaggatggtaca
tataccgtgaccaatgtgggtacgtttgggagtgtttttggaacccccatcatcaatcaa
cctcaagtaggtattcttgcacttggggcaattcgaaagattccttctgtgattgaaaca
aatgaaggcgattttattggtattcggagtaaaatgtatatctctcatagttatgaccat
agggttgttaatggtgctttaggcagtatgtttgcaaaagcggtggccgattatcttgag
gcgtgggatattaatagagaagtttag

DBGET integrated database retrieval system