KEGG   Maribacter sp. HTCC2170: FB2170_15981Help
Entry
FB2170_15981      CDS       T01306                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    FB2170_15981
DNA repair and recombination proteins [BR:fbc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      FB2170_15981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3831960..3832580)
Genome map
AA seq 206 aa AA seqDB search
MDFSSKLLENAVYEMSQLPGIGKRTALRLVLHLLKQPTEQTMKLSVALQDLRNTVKFCAN
CHNISDVELCEICANPKRDESIVCVVEDIRDVMAIENTGQFKGLYHVLGGKISPMEGVGP
QELTISSLVSKAKEGKIKEMIFALSSTMEGDTTNFYIYKQLQGLDIATSTIARGIAIGDE
LEYADEVTLGRSILNRIPFEGSLKAN
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcatcaaagctattggagaacgcggtttatgagatgtctcaattgcctggt
ataggtaagcgcaccgcattgcgattggtgttgcatttgctgaaacagccaaccgagcag
accatgaagttgtcagtagcgttacaagaccttagaaacaccgttaagttctgtgccaat
tgtcataatatatccgatgttgagttatgtgaaatatgtgccaacccaaaaagggatgaa
agtattgtatgtgtggtagaggatattcgagatgttatggcgatcgaaaatacaggacaa
ttcaaagggctttatcatgttcttggtggaaaaatatcacctatggaaggtgtggggccg
caagaattgactatctcatcattagtgagcaaagccaaagagggtaaaataaaagaaatg
atttttgccttaagttcgaccatggaaggggatactaccaatttttacatttataaacag
ctgcaaggattagatattgcaacttctaccattgcccgtgggattgccattggggatgaa
ttggagtatgcagatgaagttactttaggtcgtagtattttaaatagaataccgtttgag
ggttctcttaaagcaaactag

DBGET integrated database retrieval system