KEGG   Maribacter sp. HTCC2170: FB2170_16296Help
Entry
FB2170_16296      CDS       T01306                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fbc01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fbc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47122..47907
Genome map
AA seq 261 aa AA seqDB search
MNILDKIILDKRKEVELKKSLIPSPQLEKSFLFERNGASLASALRNSSTGIIAEHKRRSP
SKSTINQNTNVGQVAKGYQNAGVCGMSVLTDIKYFGGSLEDLLLARASVEIPLLRKEFII
DEYQILEAKAHGADVILLIAAVLTKSEIKTFSELAKSLGLDVLLEVHNEEELHKSIMPSL
DMLGVNNRNLKTFEVSLETSKTLSQLIPHEFVKVSESGISTVEAIKELKPYGYQGFLIGE
NFMKTENPGKSANDFISAIRS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctagacaaaataattcttgataaacgaaaagaggtagagttaaagaaatct
ctgattccatcgcctcaattggaaaaatcttttctttttgaaaggaatggtgcttctctc
gcatctgctttaagaaatagttcaaccggaatcattgcagaacataaaaggcgttcccct
tcaaaatcaacaattaatcaaaatacaaatgttggacaagttgccaaaggctatcagaat
gccggtgtttgtggaatgagtgttcttaccgatattaaatattttggtggttcattagaa
gacttgctgttggcacgagcctcggttgaaatacctttacttcgtaaagaatttattatt
gacgaatatcaaatacttgaggccaaagcacatggcgccgatgtaatacttttgattgct
gcagttttgaccaaatccgaaatcaaaaccttttcagaattagcaaaaagtctagggtta
gatgtgttattagaggttcataacgaagaggaattacataaatcaattatgcccagttta
gatatgcttggtgtaaataacaggaatctaaaaaccttcgaagttagcttagaaaccagt
aaaacgctttctcaattgattccccatgaatttgtaaaagtatctgaaagtggaatcagt
actgttgaggctatcaaagaattgaaaccatatgggtatcaagggtttttaatcggggag
aatttcatgaaaacggagaatcctggcaaaagcgccaatgattttataagcgcaattaga
agttaa

DBGET integrated database retrieval system