KEGG   Maribacter sp. HTCC2170: FB2170_16296Help
Entry
FB2170_16296      CDS       T01306                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_16296
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16296
Enzymes [BR:fbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FB2170_16296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47122..47907
Genome map
AA seq 261 aa AA seqDB search
MNILDKIILDKRKEVELKKSLIPSPQLEKSFLFERNGASLASALRNSSTGIIAEHKRRSP
SKSTINQNTNVGQVAKGYQNAGVCGMSVLTDIKYFGGSLEDLLLARASVEIPLLRKEFII
DEYQILEAKAHGADVILLIAAVLTKSEIKTFSELAKSLGLDVLLEVHNEEELHKSIMPSL
DMLGVNNRNLKTFEVSLETSKTLSQLIPHEFVKVSESGISTVEAIKELKPYGYQGFLIGE
NFMKTENPGKSANDFISAIRS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctagacaaaataattcttgataaacgaaaagaggtagagttaaagaaatct
ctgattccatcgcctcaattggaaaaatcttttctttttgaaaggaatggtgcttctctc
gcatctgctttaagaaatagttcaaccggaatcattgcagaacataaaaggcgttcccct
tcaaaatcaacaattaatcaaaatacaaatgttggacaagttgccaaaggctatcagaat
gccggtgtttgtggaatgagtgttcttaccgatattaaatattttggtggttcattagaa
gacttgctgttggcacgagcctcggttgaaatacctttacttcgtaaagaatttattatt
gacgaatatcaaatacttgaggccaaagcacatggcgccgatgtaatacttttgattgct
gcagttttgaccaaatccgaaatcaaaaccttttcagaattagcaaaaagtctagggtta
gatgtgttattagaggttcataacgaagaggaattacataaatcaattatgcccagttta
gatatgcttggtgtaaataacaggaatctaaaaaccttcgaagttagcttagaaaccagt
aaaacgctttctcaattgattccccatgaatttgtaaaagtatctgaaagtggaatcagt
actgttgaggctatcaaagaattgaaaccatatgggtatcaagggtttttaatcggggag
aatttcatgaaaacggagaatcctggcaaaagcgccaatgattttataagcgcaattaga
agttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system