KEGG   Maribacter sp. HTCC2170: FB2170_16296Help
Entry
FB2170_16296      CDS       T01306                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01130  Biosynthesis of antibiotics
fbc01230  Biosynthesis of amino acids
Module
fbc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16296
Enzymes [BR:fbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     FB2170_16296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: EAR00662
UniProt: A4AT92
Position
47122..47907
Genome map
AA seq 261 aa AA seqDB search
MNILDKIILDKRKEVELKKSLIPSPQLEKSFLFERNGASLASALRNSSTGIIAEHKRRSP
SKSTINQNTNVGQVAKGYQNAGVCGMSVLTDIKYFGGSLEDLLLARASVEIPLLRKEFII
DEYQILEAKAHGADVILLIAAVLTKSEIKTFSELAKSLGLDVLLEVHNEEELHKSIMPSL
DMLGVNNRNLKTFEVSLETSKTLSQLIPHEFVKVSESGISTVEAIKELKPYGYQGFLIGE
NFMKTENPGKSANDFISAIRS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctagacaaaataattcttgataaacgaaaagaggtagagttaaagaaatct
ctgattccatcgcctcaattggaaaaatcttttctttttgaaaggaatggtgcttctctc
gcatctgctttaagaaatagttcaaccggaatcattgcagaacataaaaggcgttcccct
tcaaaatcaacaattaatcaaaatacaaatgttggacaagttgccaaaggctatcagaat
gccggtgtttgtggaatgagtgttcttaccgatattaaatattttggtggttcattagaa
gacttgctgttggcacgagcctcggttgaaatacctttacttcgtaaagaatttattatt
gacgaatatcaaatacttgaggccaaagcacatggcgccgatgtaatacttttgattgct
gcagttttgaccaaatccgaaatcaaaaccttttcagaattagcaaaaagtctagggtta
gatgtgttattagaggttcataacgaagaggaattacataaatcaattatgcccagttta
gatatgcttggtgtaaataacaggaatctaaaaaccttcgaagttagcttagaaaccagt
aaaacgctttctcaattgattccccatgaatttgtaaaagtatctgaaagtggaatcagt
actgttgaggctatcaaagaattgaaaccatatgggtatcaagggtttttaatcggggag
aatttcatgaaaacggagaatcctggcaaaagcgccaatgattttataagcgcaattaga
agttaa

DBGET integrated database retrieval system