KEGG   Maribacter sp. HTCC2170: FB2170_16306Help
Entry
FB2170_16306      CDS       T01306                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_16306
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_16306
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16306
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FB2170_16306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
48568..49749
Genome map
AA seq 393 aa AA seqDB search
MSYNANERGYYGEFGGAFIPEMLYPNTEKLRLNYIRIMNEPSFKKEFDQLLKDYVGRPTP
LYFAERLSKKYNTKIYLKREDLCHTGAHKVNNTIGQILMAKKLGKKRIIAETGAGQHGVA
TATVCALMGIECVVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDWI
NNPVDTHYIIGSVVGPHPYPDMVARFQSIISEEIKWQLMEKEGVENPNYVVACVGGGSNA
AGAFYHFLDNPDVGIIAVEAAGKGIDSGESAATSALGEVGIIHGSKTLLMQTKDGQITEP
YSISAGLDYPGVGPMHAHLFKSGRGEFISITDDEAMKAGLMICKLEGIIPAIESSHAFAI
LDDKKFKPEDVVVINLSGRGDKDLDTFIKYFDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagttataacgcaaacgaaagggggtattatggtgaattcggaggagcatttattcca
gaaatgctttatccaaatacagaaaagttacgccttaattatattcgaataatgaatgaa
ccatcattcaaaaaagagttcgaccaattattaaaagattatgtaggccgacccaccccc
ctctattttgcggagcgcctctcaaaaaaatacaatacaaaaatttatctcaaaagagaa
gacctttgtcacacaggagctcacaaagtcaacaatacaatcggtcagattttaatggct
aaaaaactgggcaaaaaaagaatcattgccgaaacaggggctggtcaacatggtgtagct
acggcaaccgtatgtgctttaatggggattgaatgtgtggtatatatgggtgagatagat
atagcccgccaagctcctaatgtagctcgtatgaaaatgttgggtgcagaagttagacct
gcattatctgggagcagaacacttaaagatgctaccaatgaagctattcgtgattggatc
aataatccagtcgatacgcattacattattggatcagttgttggaccccacccctacccc
gatatggtagcgcgatttcaatccatcatatccgaagaaatcaaatggcaactaatggaa
aaagaaggggttgaaaatcctaactatgtagtggcctgtgttggtggaggcagtaatgcc
gcaggtgcattttaccattttctggataatccagatgttggaatcattgcagttgaagcc
gcgggcaaaggaatagattcgggtgagagtgcggcaacttcagcgcttggagaagtaggt
atcattcatggaagtaaaaccctcttgatgcaaacaaaagatggtcaaatcaccgaaccc
tattctatttctgctggattggactatccaggagttggacctatgcacgcccatttgttt
aaatctggaagaggagaattcatctcaataacagatgatgaggcaatgaaagcaggtttg
atgatttgtaaactagaaggcataattcctgccattgaaagctcacatgcatttgcaatt
ttagatgataaaaagttcaaaccagaagatgttgttgttattaatttatccggaagaggg
gataaggatttggacacatttattaaatattttgatttatga

DBGET integrated database retrieval system