KEGG   Maribacter sp. HTCC2170: FB2170_16311Help
Entry
FB2170_16311      CDS       T01306                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_16311
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_16311
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16311
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FB2170_16311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49746..50528
Genome map
AA seq 260 aa AA seqDB search
MNRINQRLLEDEKILSIYFTAGFPKIDDTVKIIEDLEKNGVDLIEIGLPFSDPLADGPTI
QESSTIALNNGMHTELLFEQIKDIRNTVSIPLIIMGYFNPIFQYGVEAFCKRCNEIGIDG
LILPDLPLDVYQDEYATIFEKYGLVNVFLITPQTSDERIKQIDEASNGFIYMVSSASTTG
ATSGFGKEQQEYFNRISSLNLKSPKIVGFGINNSETFRQATRTTSGAIIGSAFIKHLRKH
GTDSISKFLKNVRESHGDNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaccaaaggctacttgaggatgaaaaaatcctatctatatattttaca
gctggttttccaaagattgatgatacggtaaaaatcatagaagatttggaaaaaaatggt
gttgatttgattgaaatcggattgcctttttcagaccccttggcagacggtcctactata
caggaatcatcgacaattgctttgaacaatggaatgcataccgaattactttttgaacag
attaaggatattcgaaatacggtttcgattccattgattatcatgggatattttaatcct
atttttcaatacggtgttgaggcattttgtaagcgttgtaatgaaattggtattgacgga
ctcattttgccggatttacctctagatgtgtatcaggacgagtatgccacaatattcgaa
aaatatggtctggtaaatgtttttcttataaccccgcagaccagtgatgagcgaattaaa
caaatcgatgaagcatcaaatggttttatttatatggtaagttctgcaagcacaactgga
gcaacttctgggtttggaaaagagcagcaagaatattttaatcgaatttcgtccctcaat
ttaaaatctccaaaaattgtcgggttcggcatcaataattctgaaacctttaggcaagca
acaagaacaacgtcaggagcaattattggttcagcatttatcaaacatttaagaaaacac
ggaactgattcaatttctaaatttctaaaaaacgttcgcgaaagtcatggagataatcaa
taa

DBGET integrated database retrieval system