KEGG   Maribacter sp. HTCC2170: FB2170_16311Help
Entry
FB2170_16311      CDS       T01306                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FB2170_16311
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FB2170_16311
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FB2170_16311
Enzymes [BR:fbc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     FB2170_16311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
49746..50528
Genome map
AA seq 260 aa AA seqDB search
MNRINQRLLEDEKILSIYFTAGFPKIDDTVKIIEDLEKNGVDLIEIGLPFSDPLADGPTI
QESSTIALNNGMHTELLFEQIKDIRNTVSIPLIIMGYFNPIFQYGVEAFCKRCNEIGIDG
LILPDLPLDVYQDEYATIFEKYGLVNVFLITPQTSDERIKQIDEASNGFIYMVSSASTTG
ATSGFGKEQQEYFNRISSLNLKSPKIVGFGINNSETFRQATRTTSGAIIGSAFIKHLRKH
GTDSISKFLKNVRESHGDNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataaaccaaaggctacttgaggatgaaaaaatcctatctatatattttaca
gctggttttccaaagattgatgatacggtaaaaatcatagaagatttggaaaaaaatggt
gttgatttgattgaaatcggattgcctttttcagaccccttggcagacggtcctactata
caggaatcatcgacaattgctttgaacaatggaatgcataccgaattactttttgaacag
attaaggatattcgaaatacggtttcgattccattgattatcatgggatattttaatcct
atttttcaatacggtgttgaggcattttgtaagcgttgtaatgaaattggtattgacgga
ctcattttgccggatttacctctagatgtgtatcaggacgagtatgccacaatattcgaa
aaatatggtctggtaaatgtttttcttataaccccgcagaccagtgatgagcgaattaaa
caaatcgatgaagcatcaaatggttttatttatatggtaagttctgcaagcacaactgga
gcaacttctgggtttggaaaagagcagcaagaatattttaatcgaatttcgtccctcaat
ttaaaatctccaaaaattgtcgggttcggcatcaataattctgaaacctttaggcaagca
acaagaacaacgtcaggagcaattattggttcagcatttatcaaacatttaagaaaacac
ggaactgattcaatttctaaatttctaaaaaacgttcgcgaaagtcatggagataatcaa
taa

DBGET integrated database retrieval system