KEGG   Maribacter sp. HTCC2170: FB2170_16991Help
Entry
FB2170_16991      CDS       T01306                                 

Definition
(GenBank) diphosphate--fructose-6-phosphate 1-phosphotransferase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00010  Glycolysis / Gluconeogenesis
fbc00030  Pentose phosphate pathway
fbc00051  Fructose and mannose metabolism
fbc00052  Galactose metabolism
fbc00680  Methane metabolism
fbc01100  Metabolic pathways
fbc01110  Biosynthesis of secondary metabolites
fbc01120  Microbial metabolism in diverse environments
fbc01130  Biosynthesis of antibiotics
fbc01200  Carbon metabolism
fbc01230  Biosynthesis of amino acids
fbc03018  RNA degradation
Module
fbc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FB2170_16991
   00030 Pentose phosphate pathway
    FB2170_16991
   00051 Fructose and mannose metabolism
    FB2170_16991
   00052 Galactose metabolism
    FB2170_16991
  Energy metabolism
   00680 Methane metabolism
    FB2170_16991
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FB2170_16991
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FB2170_16991
Protein phosphatases and associated proteins [BR:fbc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FB2170_16991
Messenger RNA biogenesis [BR:fbc03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FB2170_16991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: EAR00801
UniProt: A4ATN1
Position
complement(197865..199199)
Genome map
AA seq 444 aa AA seqDB search
MEMKNEEMFDINVLGKALFDSPLGLSKVQGDDIFNFVNEDEKILQNISLKEFKKNTADAK
EPLAMEKAGPREKIFFDPKKTTAAVVTCGGLCPGINNVIRSLVMGLHYFYGVKEILGVRY
GFEGLNPSYEHGFVNLTPEYVKDIHEFGGTILGSSRGGQDIGIMVDTLVDNGVDLLFTIG
GDGTLKGANAIGEEIEKRGLNISVIGIPKTIDNDINLIDKSFGYETAYHVANPIIRDAHN
EATGAYNGIAIVKLMGRDSGFIAASAAISMPVVNFVLIPEMHFELEGENGFLETLKKRLD
SKHHAVIVVAEGAGQNLFNKDKNGQLTDASGNIQHDDIGLFLKNSIADYFKKNNYEVTIK
YIDPSYIIRSAPANPGDSVFCSGLAYHAVHGAMSGRSKFVVGRVNNQYVYLPITAVTNKR
KKINMEGGYWYAALESTGQPFEMR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaaaacgaagaaatgttcgatattaatgttctgggaaaagctttatttgat
tctcctttggggttaagtaaagttcaaggtgatgatatattcaattttgtcaacgaagat
gaaaaaatactacagaatatctctctaaaagaattcaagaagaatactgctgatgcgaag
gaacctttagctatggaaaaagcgggtccgagagaaaagatcttttttgatcccaaaaaa
accacagcggcagttgttacttgtgggggattgtgccctggaattaataatgtgattcga
agccttgtaatggggttacattacttttacggtgtcaaggaaatattgggtgtccgttat
ggttttgaaggattaaacccttcatacgagcacggttttgtgaatctaacgccagaatat
gtcaaggatatccatgaatttggaggaacaattctgggttcgtccagaggtggtcaggat
attggtataatggtggataccttggttgataatggtgttgatttgttatttaccattggt
ggtgatggaactttaaaaggtgccaatgccattggtgaggaaatagaaaaacgtggtttg
aatatttcggtcataggtattccgaaaacaatagataacgatattaatcttattgacaag
tcgtttggatatgaaacggcttatcatgttgcaaatccaattattagggatgctcataat
gaagcaactggtgcctataatggcattgccattgtaaaactaatgggtcgagatagtggt
tttatagcagcatcagcggcaatatcaatgcccgttgtaaactttgttttgattccggaa
atgcattttgaactcgagggtgaaaacggatttttagaaacgcttaaaaaaaggttggat
tcaaaacatcatgcggttatagtagtggccgaaggagcaggacagaatcttttcaacaaa
gataagaacgggcaacttacagacgcctctgggaatattcagcatgatgacattgggcta
tttttgaaaaatagtatagctgattattttaagaaaaataactacgaagtcaccataaaa
tatatagacccaagttatattattaggagtgcgccagccaatcctggagatagcgttttt
tgtagcggattggcttatcatgcagtacatggagctatgtctggaaggagtaaatttgta
gtcggtcgagttaataatcaatatgtatacttaccgataacagcagtaaccaacaaaaga
aagaaaattaatatggaaggcggttattggtacgccgctctagaaagtacaggacagccc
tttgagatgcgctaa

DBGET integrated database retrieval system