KEGG   Maribacter sp. HTCC2170: FB2170_17291Help
Entry
FB2170_17291      CDS       T01306                                 

Definition
DfrA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FB2170_17291
   00670 One carbon pool by folate
    FB2170_17291
Enzymes [BR:fbc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     FB2170_17291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262751..263230
Genome map
AA seq 159 aa AA seqDB search
MIAAVGENNALGKDNDLLWHLPDDFKRFKQLTTGHYIIMGRKTFESFPKPLPNRTHIIIT
RDENYKVEHPECRVVHSLENAIKLTKNDKNPFIIGGGEIYKQGEKFADKLEITRVHENFN
ADTYFPEVNENIWKLVESEYHPKNEKHKYDFTYLTYVRM
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatagcggctgttggcgaaaacaatgctttgggcaaagacaacgatttgctttggcat
ttgcccgatgattttaagcgatttaaacaattgaccacaggtcattatataatcatgggt
agaaagacttttgaaagctttccaaaaccattgcccaacagaactcatattattattaca
agagatgaaaattataaagttgaacatcctgaatgcagggtcgtacactcgctggaaaat
gcaataaaactgaccaaaaatgataaaaatcctttcattatcggtggcggtgaaatctat
aaacaaggagagaaatttgctgataaattagaaataactagggtgcatgaaaattttaac
gctgacacttattttccggaagtgaatgagaacatctggaaattggttgaatcagaatac
catcctaaaaatgaaaagcataaatacgattttacgtatttgacttatgttagaatgtaa

DBGET integrated database retrieval system