KEGG   Ferrimonas balearica: Fbal_0044Help
Entry
Fbal_0044         CDS       T01318                                 

Definition
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC:4.2.99.20)
Orthology
K02551  
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
fbl  Ferrimonas balearica
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Fbal_0044
Enzymes [BR:fbl01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     Fbal_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(55109..56818)
Genome map
AA seq 569 aa AA seqDB search
MNTSHCAELNLLWARLMLEELHRLGVRHLCLAPGSRSTPLTLAAAGHDGFQRHTHFDERG
LGFAALGLAKASQSPVAIITTSGTAVANLYPAVIEAYQTGVPLVVLSGDRPPELIACGAN
QAIIQPAIFANYARRLDLPTPSLEIPPQTLLAQLDQVMVDLDRPLHINCMYREPLYPEGL
DAPFETYLTPLSEWRKTAEPWAATPAMSRSALPSADDCCSFAQGKGIIVVGTLGPHQQPE
QILALARRLGWPILADAQSQLRQAEGVVHHIDQLMHHPKALKLLGKAEHLLLIGGRLLSK
RLMSFIAQHPWQAFWHYMGHAENLDPAHLRKRRFVGSLPMLAALPWPLLPGSGWADALES
YSDEVERLAAEQHDQGALTELSAVRLLSRQLGADQQLFIGNSLPIRLFDMLAAPGDAPAI
FTNRGASGIDGLLATSCGVAMAEGKPTVLVVGDLSLLHDLNSLALARSLTSPLVVMVLNN
DGGSIFNMLPVPSDALRQQYYRLGHGFGFEGAASQFHLPYQRPDSLDALQQALSEGLQRD
GASVIEVVVPPNESAELIVEMARQIRGDD
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaacacctcgcactgcgccgaattgaacctgttgtgggcgcgactgatgctggaggag
ttgcaccgccttggtgtgcgtcatctctgcctggcaccgggttcccgctccaccccgctg
accctggctgcggccggtcacgacggtttccaacgccacacccatttcgatgaacggggc
ctgggcttcgccgccctcggcctggccaaagccagccagagcccggtcgccatcatcacc
acctccggcaccgccgtcgccaacctctatccggcggtgatcgaagcctatcagaccggc
gttccgctggtggtgctatccggtgaccgaccgccggagctgatcgcctgtggtgccaac
caggccatcatccagccagccatctttgccaactacgcccgtcgtctcgacctgccgacc
ccaagcctggagatcccgccgcagaccctgctggcccagctcgaccaggtgatggtggat
ctcgaccgcccgctgcacatcaactgcatgtaccgcgagccgctctatccggaaggcctg
gacgcgccgtttgagacctacctgacaccgctgagtgagtggcgcaaaaccgctgagccc
tgggccgctaccccggccatgagccgcagtgccctgcccagcgccgacgactgctgcagc
tttgcccagggcaagggcatcatcgtggtaggcaccctgggccctcaccagcaaccggaa
cagattctggctctggcccgccgactgggctggcccattctggccgatgcccaatcgcaa
ctgcgtcaggccgagggtgtggtacaccacatcgaccagctgatgcatcaccccaaggca
ctgaagcttctgggcaaagctgaacatctgctgctgattggcggacgtctgctctccaag
cgactgatgagctttatcgcccagcatccgtggcaggcgttctggcactacatgggccac
gccgagaatctggatccggcccatctgcgcaagcgccgctttgtcggcagcctgccgatg
ctggccgccctgccctggccactgctgcccggctccggctgggccgatgcgctggagtcc
tacagtgacgaagtggaacggctggccgcagagcagcatgatcagggcgcattgaccgaa
ctgtccgccgtccgtctgctgtcgcgccaactgggcgctgaccagcagctgtttatcggt
aacagcctgccgatccgcctgtttgacatgttggcagccccgggtgatgccccggccatc
ttcaccaaccgtggcgcctccggcattgatggcctgctcgccaccagctgtggcgtggca
atggccgaaggcaaaccgacggttctggtggtaggcgacctgtcactgctgcacgacctc
aactccctggcattggcccgcagcctgaccagcccgctggtggtgatggtgcttaacaac
gacggcggcagcatcttcaatatgctgccggtgcccagtgacgccctgcgtcagcagtac
taccgccttggccacggctttggttttgaaggggccgccagccagttccatctgccctac
cagcgccccgacagtctggatgccctgcagcaagccctcagcgaagggctgcagcgtgac
ggtgccagtgtgatcgaggtggtggtgccgcccaacgaatcggccgagctgattgtggag
atggcacgccagatccggggcgatgactga

DBGET integrated database retrieval system