KEGG   Ferrimonas balearica: Fbal_0047Help
Entry
Fbal_0047         CDS       T01318                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
fbl  Ferrimonas balearica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Fbal_0047
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Fbal_0047
Exosome [BR:fbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fbal_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(58884..60428)
Genome map
AA seq 514 aa AA seqDB search
MMKTNPQAKPAMSSEQFILALDQGTTSSRALLFNRQGTILGSAQREFTQHYPQSGWVEHD
AMEIWASQRAVLTEVLARCGVRHEQVAAIGITNQRETTVIWDAETGQPIHNAIVWQCRRT
ADLCEALKAKGLEQHVRDTTGLVLDPYFSGTKIAWLLDQVPGARERAERGELRFGTIDCW
LLWQLTDGAVHATDRTNAARTLLWDIHQQRWDPTLLDALNIPASLLPEVKSSQELFGHAQ
IGRARIPVAGIAGDQQAALFGQLCTQPGMAKNTYGTGCFMLMHTGDQAVQSRHGLLTTIA
CSGPEQVEYALEGAVFMGGASVQWLRDELGLIRHASETQALAQSVPDTAGAYLVPAFTGL
GAPYWDPYARGALVGLTRGCNRQHIVRATLESIAYQSRDLLDAMQLDAALPLTELRVDGG
AVANDFLMQFQADILATPVLRPHNRESTAAGAAYLAGLTVGYWPDRASLAGLNQTERRFE
STMDDTQRQQLYSGWQDAVGRTLVTKAPHPGSGQ
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaacaaatccccaagccaaacccgccatgtcgagcgaacaatttatccttgcc
ctggatcagggcaccacctccagccgcgccctgctgtttaaccgccagggcaccatcctt
ggcagcgcccagcgcgaatttacccaacactacccacaatccggctgggtcgagcacgac
gccatggagatctgggccagccagcgtgcggtactgaccgaggtgctggcacgctgtggt
gtccgccatgagcaggtggccgccatcggcatcaccaaccagcgggaaaccacggtgatc
tgggacgccgaaaccggccagcccatccacaatgccattgtctggcagtgccgccgcacc
gccgacctgtgcgaagcgctcaaagccaaagggctggaacagcacgtccgtgataccacc
ggattggtgctcgacccctacttctccggcaccaagatcgcctggctgctggaccaggtt
cccggtgcccgggagcgggcagaacggggcgagctgcgcttcggcaccatcgactgctgg
ctactgtggcaactgaccgacggcgccgtgcacgccaccgaccgcaccaacgccgcccgc
accctgctgtgggacattcaccagcagcgctgggaccccaccctgctggacgccctgaac
attcccgccagcctgctgcctgaggtgaaaagcagtcaggagctgtttggccacgcccag
attggtcgcgcccgcattccggtggctggcatcgccggtgaccagcaggcggccctgttc
ggccagctctgcacccaaccggggatggccaaaaacacctatggcaccggctgctttatg
ctgatgcacaccggcgaccaggcggtgcagtcccgccatgggctgctgaccaccatcgcc
tgcagtggcccggaacaggtggagtacgcgcttgagggcgcggtgtttatgggcggcgcc
agcgtgcagtggctgcgggatgagctggggctcattcgccacgccagtgaaacccaggct
ctggcccagtcggtgccggacaccgctggcgcttacctggtgccagcctttaccgggctg
ggtgcgccctactgggatccctacgcccgcggtgcgctggtgggcctgacccgaggctgc
aaccgccagcacattgtccgcgccacactggaatccatcgcctatcagagccgcgacctg
ctggatgccatgcagctggacgccgccctgccgttgaccgagctccgggtcgacggaggg
gccgtggccaatgactttctgatgcagttccaggccgacatcctcgccaccccggtgctg
cgcccccataaccgggagagcaccgccgccggcgccgcctatctggcgggcctgaccgtc
ggctactggccggatcgcgccagcctggccggactgaaccagaccgaacgccgcttcgag
tccaccatggatgacactcagcgccagcagctctattcgggctggcaggatgcggtgggg
cgtaccctggtcaccaaggcaccacacccgggatccggtcagtaa

DBGET integrated database retrieval system