KEGG   Ferrimonas balearica: Fbal_0226Help
Entry
Fbal_0226         CDS       T01318                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fbl  Ferrimonas balearica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Fbal_0226
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Fbal_0226
Transfer RNA biogenesis [BR:fbl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Fbal_0226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
245788..246621
Genome map
AA seq 277 aa AA seqDB search
MVTPLHTLLEPVITIARDAGQQIRTIYEAGQYQSLTKSDNTPVTSADLAAHEWIVTALRT
LTPDTPILSEEDADIPLSTRQHWNEYWLIDPLDGTQEFIAGSGEFAVNIALVRDHQPVLG
VIYAPMSEVWYYACQGHGAYKRHGDQTEAIHSRDVGPGDALKIAVSRRQRREAVMSRLDE
QREYLLLPFGSASLKSCMVAEGTADCYLRLGPTGEWDTGASQCIVEEAGGRIVDTCYQPL
SYNERESLENPNYMVLGCQSLPWQEILPPGPECYSAE
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtggtgactcccctgcacacactgctagaacccgtcatcaccattgcccgtgatgcggga
caacagatccgcaccatctacgaggcgggtcaatatcagtccctgaccaaatccgacaac
acccccgtgacctcggccgacctggccgcccatgagtggatcgtcacggcgctgcgaacg
cttaccccggacacacccatcctctccgaggaggacgccgatatcccgctgtccacccgc
cagcactggaatgagtactggctgattgacccgctggacggcacccaggagtttattgcc
ggcagtggcgagtttgcggtgaacattgcgctggtgagggatcatcagcctgtgctgggg
gtgatctacgcgccgatgagtgaagtctggtactacgcctgtcagggccacggcgcctac
aagcgccacggtgaccagactgaagcgatccacagtcgtgatgtggggccgggggacgca
ctgaagattgcggtcagccgccgtcagcgtcgcgaagcggtgatgtcacggctggatgaa
cagcgggaatacctgctgctgccatttggcagtgcgtcactgaaatcctgcatggtggcg
gaaggcaccgcggattgctatctgcgccttgggccgaccggcgagtgggacaccggagcc
tcccagtgcatcgttgaggaagcgggcggcaggatcgtcgacacctgctaccaaccgttg
agctacaacgagcgcgagagcctggaaaaccccaactacatggtgttgggctgtcagagc
ctgccctggcaagagattctgcctccgggcccggagtgttattcagcggaatag

DBGET integrated database retrieval system