KEGG   Ferrimonas balearica: Fbal_0232Help
Entry
Fbal_0232         CDS       T01318                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.1 1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fbl  Ferrimonas balearica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:fbl01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:fbl01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(253984..255105)
Genome map
AA seq 373 aa AA seqDB search
MTDNKPRLILVNSAIFALTFLTALIAVPLYGLWQGYQSEALWVALLFWAWSGLSITAGYH
RLWSHKAYSTHPVVQWVLAIGGAMAMQNSILHWASDHRRHHKHVDDNERDPYSAGRGFWY
SHIGWMLREYQQVTPDIYNNVRDLQKNPIVMNQHNHYGKWVFATNIALPAFIGWLTGDIL
GMLLLAGVLRLVLVHHGTFFINSLAHIWGSQPYSDKHSSRDNGFIALATFGEGYHNFHHT
FEYDYRNGIRWWHFDPTKWLIRGLAKLGLAKDLRRVPTERIESARLAMQLQSSQRLLAEH
HSASEWLAKLEEEYERLLAELQRYYGEKQRQLKLHKHELDRSTRARLNELRQTFQQQKRQ
WQALRAQLHAQVA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgactgataacaagccccgtctcatcctcgtcaatagcgccatcttcgcattgacgttc
ctgaccgccctgatcgcggtgccgctttacggcctgtggcagggataccaaagcgaagcg
ctttgggtggcgctgctgttctgggcctggagtggcctgtccatcactgccggttaccac
cgcctgtggtcccacaaggcctacagcacccatccggtggtgcagtgggtgttggccatc
ggtggcgccatggcgatgcaaaattccatcctgcactgggcctctgaccaccgtcggcac
cataaacacgtggacgacaacgagcgcgacccctactccgctggccggggattctggtac
agccacatcggttggatgctgcgcgagtatcaacaggttaccccggatatttacaacaat
gtccgcgacctgcagaagaatcccatcgtgatgaatcaacacaaccactacggcaagtgg
gtgttcgccaccaacatcgccctgccggccttcatcggttggctcactggtgacatcctg
ggcatgttgctgctggctggggtactgcgcctggtgttggtgcaccacggcaccttcttt
atcaactcgctggcccacatttggggcagccagccttacagtgacaaacacagctcccgc
gacaacggttttatcgccctggccaccttcggagagggctaccacaacttccaccacacc
tttgagtacgactaccgtaacggcatccgctggtggcactttgaccccaccaagtggctg
atccgcggcctggccaaactgggtctggccaaggacctgcgccgtgtgccgacagagcga
atcgaatccgcccgcctggcgatgcagctgcaatccagtcaacgcctgttagctgagcac
cacagtgccagtgagtggctggcgaagctggaggaggagtacgagcgcctgctggccgag
cttcagcgctattacggtgagaaacagcgccagctgaagctgcacaaacatgagttggat
cgctccacccgcgcccgactgaatgagctgcgccagaccttccagcagcaaaaacgccaa
tggcaggccctgcgcgcccagttgcacgcccaggtggcctga

DBGET integrated database retrieval system