KEGG   Ferrimonas balearica: Fbal_0232Help
Entry
Fbal_0232         CDS       T01318                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.1 1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
fbl  Ferrimonas balearica
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Fbal_0232
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Fbal_0232
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Fbal_0232
Lipid biosynthesis proteins [BR:fbl01004]
 Desaturase
  First
   Fbal_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(253984..255105)
Genome map
AA seq 373 aa AA seqDB search
MTDNKPRLILVNSAIFALTFLTALIAVPLYGLWQGYQSEALWVALLFWAWSGLSITAGYH
RLWSHKAYSTHPVVQWVLAIGGAMAMQNSILHWASDHRRHHKHVDDNERDPYSAGRGFWY
SHIGWMLREYQQVTPDIYNNVRDLQKNPIVMNQHNHYGKWVFATNIALPAFIGWLTGDIL
GMLLLAGVLRLVLVHHGTFFINSLAHIWGSQPYSDKHSSRDNGFIALATFGEGYHNFHHT
FEYDYRNGIRWWHFDPTKWLIRGLAKLGLAKDLRRVPTERIESARLAMQLQSSQRLLAEH
HSASEWLAKLEEEYERLLAELQRYYGEKQRQLKLHKHELDRSTRARLNELRQTFQQQKRQ
WQALRAQLHAQVA
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgactgataacaagccccgtctcatcctcgtcaatagcgccatcttcgcattgacgttc
ctgaccgccctgatcgcggtgccgctttacggcctgtggcagggataccaaagcgaagcg
ctttgggtggcgctgctgttctgggcctggagtggcctgtccatcactgccggttaccac
cgcctgtggtcccacaaggcctacagcacccatccggtggtgcagtgggtgttggccatc
ggtggcgccatggcgatgcaaaattccatcctgcactgggcctctgaccaccgtcggcac
cataaacacgtggacgacaacgagcgcgacccctactccgctggccggggattctggtac
agccacatcggttggatgctgcgcgagtatcaacaggttaccccggatatttacaacaat
gtccgcgacctgcagaagaatcccatcgtgatgaatcaacacaaccactacggcaagtgg
gtgttcgccaccaacatcgccctgccggccttcatcggttggctcactggtgacatcctg
ggcatgttgctgctggctggggtactgcgcctggtgttggtgcaccacggcaccttcttt
atcaactcgctggcccacatttggggcagccagccttacagtgacaaacacagctcccgc
gacaacggttttatcgccctggccaccttcggagagggctaccacaacttccaccacacc
tttgagtacgactaccgtaacggcatccgctggtggcactttgaccccaccaagtggctg
atccgcggcctggccaaactgggtctggccaaggacctgcgccgtgtgccgacagagcga
atcgaatccgcccgcctggcgatgcagctgcaatccagtcaacgcctgttagctgagcac
cacagtgccagtgagtggctggcgaagctggaggaggagtacgagcgcctgctggccgag
cttcagcgctattacggtgagaaacagcgccagctgaagctgcacaaacatgagttggat
cgctccacccgcgcccgactgaatgagctgcgccagaccttccagcagcaaaaacgccaa
tggcaggccctgcgcgcccagttgcacgcccaggtggcctga

DBGET integrated database retrieval system