KEGG   Ferrimonas balearica: Fbal_0341Help
Entry
Fbal_0341         CDS       T01318                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fbl  Ferrimonas balearica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Fbal_0341
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fbal_0341
Enzymes [BR:fbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Fbal_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
373687..375150
Genome map
AA seq 487 aa AA seqDB search
MSSLDDLLAPWMALDTGVEFQQLVLDSRRVRPGDCFVAVAGHQVDGRDFIDSAIALGAVA
VLADADADGRQADRNGVIVVGVHNLSQRLSALALRAYPAATRPTLIGVTGTNGKTTVTQL
CAQLLTALGHQAGVMGTVGNGLWGDLIPSVNTTSDAITVARELDRQAKSGAEAVALEISS
HGLSQSRVAALPVQVGVYTNLSRDHLDYHGDMAAYADAKRQLFALPGLRHGVFNLDDETG
SRWHRELSGSLLALGYSIQGARCDGAYLTVEGVEYHDQGVRARVVSSFGQGTLNSPLLGA
FNLANLLAALGALLSLGYSLSDLLSVVPQLHSAAGRMECFGTDSTPTLVVDYAHTPDALS
QALAALRPHCRGALWCVFGCGGERDSGKRPLMAQAAEQGADHLIITADNPRSEAFADIAA
QMEAGLTGQAEVIEDRAAAVRRAFAQAQPGDMVLLAGKGHEDYQIIGGNRLDYNERALAQ
QLVEQGV
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcactcgatgatttgctggctccctggatggcgcttgataccggggtggagttt
caacagttggtgttggacagccgacgtgtccgcccgggagattgttttgttgccgtggct
ggccaccaggtggacggccgcgattttattgattcggcgatcgcgcttggcgcggtggcc
gtgctggcggacgccgatgcggatggacgtcaggcggaccgcaatggcgtgatcgtggtt
ggcgtgcacaacctgtcccagcgcctgtcggcgctggcccttcgcgcctacccggcagcc
acccgtccaaccctgatcggcgtcaccggcaccaacggcaaaaccacggtcacccagctg
tgtgcgcagctgctgacggcgctgggacaccaggctggggtgatggggaccgtggggaac
gggctgtggggggatctgatcccatcggtcaacaccacctccgacgccattaccgtggcc
cgggagctggaccgccaggccaagtccggtgctgaagccgtggctctggagatctccagc
cacggcctgagccaatcccgggtggcggcattgccggttcaggtaggggtctacaccaac
ctgagtcgggatcacctcgattatcacggcgacatggccgcgtacgctgacgccaagcgc
cagctgtttgccctgccgggcctgcgccatggcgtgtttaacctggatgacgaaaccggc
tctcgctggcatcgcgagctgtcaggcagcctgctggcgctgggttacagcattcaggga
gcccgctgtgacggcgcttatctgaccgtcgaaggggtggagtatcacgaccagggcgtg
cgtgcccgggtggtgtccagctttggtcagggcacgctgaacagtccattgctgggcgca
ttcaatctggccaaccttttggccgctctgggagcattactgagtctcggttattcgctg
tcggatctgctgtccgtagtgcctcagttgcacagtgccgctggccggatggaatgtttc
ggcaccgacagtaccccgactctggtggtggactatgcccacacgccggacgccctcagt
caggccctggctgccctacgaccgcactgtcgtggcgcactgtggtgcgtattcggctgt
ggtggcgagcgggacagtggcaagcggccgctgatggcgcaagccgccgagcagggcgcc
gaccacctgatcattaccgccgataatccgcgcagcgaggcgtttgccgacatcgctgcc
cagatggaagcgggcctgaccggtcaggcagaggtgattgaggaccgggctgcggcggtg
cgccgcgcctttgcccaggctcagcccggtgacatggtgttgctggcgggcaagggccat
gaagattaccaaatcattggcggtaaccgcctggattacaacgagcgcgcgctggcgcaa
caattggtggagcagggcgtatga

DBGET integrated database retrieval system