KEGG   Ferrimonas balearica: Fbal_0691Help
Entry
Fbal_0691         CDS       T01318                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00480  Glutathione metabolism
fbl00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Fbal_0691
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fbal_0691
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Fbal_0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ADN74902
JGI: Fbal_0691
UniProt: E1SRT3
Position
complement(758100..758636)
Genome map
AA seq 178 aa AA seqDB search
MKPLLPLLLLASASVSAAQCPAWLDTEKRRLHSKESVNLCELTANKAVLLVNTASHCGFT
PQFKELEALHQQYGADGLVVIGMPSDDFFQEADDEAETAEVCYRNYGVSFTMLTPAAVRG
SDADPIFAELARQGGAPKWNFYKYLVDQDGKLVDYWSPKTDPSDPEITGAIESLLNGS
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgctactccctctcctgctgctggccagtgccagcgtctctgctgcccagtgt
ccggcctggctcgacaccgaaaagcgccgcctgcactccaaagagagtgtgaacctgtgc
gaactgaccgccaacaaggcggtactgctggtcaataccgccagccactgtggcttcacc
ccccagttcaaagagcttgaggccctgcaccaacagtacggtgcggatggcctggtggtg
attggtatgccctctgacgacttcttccaggaagcggatgacgaagcggaaaccgccgaa
gtctgttaccgcaactacggcgtcagcttcaccatgctgaccccggcagcggttcgtggc
tccgacgccgaccccatctttgccgaactggcccgccagggcggcgcaccgaagtggaat
ttctacaaatacctggtggatcaggacggcaaactggtggactactggtccccgaaaacc
gacccgagcgatccggagatcaccggggccattgagtcgttgctgaacggctcctga

DBGET integrated database retrieval system