KEGG   Ferrimonas balearica: Fbal_0768Help
Entry
Fbal_0768         CDS       T01318                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fbl  Ferrimonas balearica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fbal_0768
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fbal_0768
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fbal_0768
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fbal_0768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
833103..834383
Genome map
AA seq 426 aa AA seqDB search
MQLYNLKQPDERVNFAEAVKRGLGQQQGLFFPEAIPALKLDEAFWQASFVERAERVLGAL
LAEELGQDNVSALVRDAFNFELPLVPATAHQYCLELFHGPTLAFKDFGARFLARTLSLVA
RDTPMTILTATSGDTGAAVADAFYGLPNIRVVVLYPDGGISELQEKLFCTLGDNIHTVAV
KGSFDDCQAMVKAAFSDAALKAEYGLTSANSINIARLLAQVVYYFEALAQLPEAERDNAV
FAVPSGNFGNLTAGLLAKAMGAPIKRFVAATNSNDTVPRYLNSGQWQPGPVHATLSNAMD
VTSPNNWPRVEALFAAQQWPLAQLAAERVSEPQTEARMVALNGEGYLSEPHAAVASEALE
RQLAEDEVGIFLGTAHPAKFQGAVEQVLNIELPLPPALAAVQDKPILSSQLAADADALKQ
YLRQRL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctataacctgaaacagcccgacgagcgggtgaactttgccgaggcggtaaag
cgcggcctgggtcagcagcaagggctgtttttccccgaggcgatcccggccctgaagctg
gatgaggcgttctggcaggccagcttcgtcgagcgcgcagagcgggtgctgggggcactg
ctggcggaggagctggggcaggacaacgtcagcgccctggtgcgggatgccttcaacttc
gaactgccgctggtgccggccaccgcccaccaatactgtttggagctgttccatggcccc
accctggcttttaaggacttcggcgcccgctttctggcccgcaccctcagcctggtggcg
cgggataccccgatgaccatcctgaccgccacctccggggataccggggcggcggtggcc
gacgccttttatggtctgccgaacatccgggtggtggtgctttatccggatgggggcatc
agtgaactgcaggagaagctgttctgtaccctgggcgataacatccacactgtggcggtg
aagggcagttttgacgactgtcaggcgatggtgaaagcggcgttttccgatgcggcgctg
aaagccgagtacggcctgacttccgccaactccattaatatcgcgcgcttgctggctcag
gtggtgtactactttgaggctctggcacagctgcccgaggcggagcgggacaacgcggtg
tttgccgtcccctccggcaactttggcaacctgaccgccggtctgctggccaaggcgatg
ggcgcgcccatcaagcggtttgttgcggccaccaacagcaatgacaccgtgccgcgttac
ctgaacagtggccagtggcaaccgggaccggtacacgccaccctctccaacgccatggac
gtcaccagccccaataactggccccgggtggaagcgctgtttgccgcccaacagtggccg
ttggcacagctggcagcggagcgggtgtccgagccgcaaaccgaagcgcggatggtggcg
cttaatggtgagggctatctgagcgagccccacgccgcggtggcatcagaagcgctggag
cgccagctggcggaggatgaggtggggatcttcctcggtaccgcccatccggccaagttc
cagggcgcggtggaacaggtgctgaacatcgaactgcctctgccgccggcgctggccgcg
gtgcaggacaagccgatcctcagtagccaactggccgcagacgccgatgcgctgaagcag
tacctgcgccagcgcctctga

DBGET integrated database retrieval system