KEGG   Ferrimonas balearica: Fbal_0807Help
Entry
Fbal_0807         CDS       T01318                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
fbl  Ferrimonas balearica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Fbal_0807
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fbal_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(888915..889547)
Genome map
AA seq 210 aa AA seqDB search
MHNRTLVTLALLGLLGGGVSQAVAEATPPQALACTACHQVGPDAKPAIGPPLWGLAERGI
ASYPGFEYSDALKQHQGQWNAERLDRFLADPNGFAPGTKMVFAGVPDPASRAVLIAWLAS
QNPTPPDWQSAQPADPAVSVGPLKPGNGAELVAAVCSGCHSLHLVTQQGLSRDSWQETLD
WMIDEQGMAPLPEDDLQRVLDYLAAHYGLE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacagaacccttgtcactctggccctgttggggctgcttgggggaggcgtcagt
caagcggtggcggaagcgactccccctcaagcactggcgtgtaccgcctgtcatcaggtg
ggccccgatgccaaacccgccatcggaccgccgctctgggggctggctgaacgtggcatc
gcctcctatccggggtttgagtacagcgacgccctgaaacagcatcagggccagtggaac
gccgagcgactggaccgttttctggccgatcccaatggctttgctccgggcacgaagatg
gtgtttgcgggggtgcctgatcccgcctcccgcgcagtactgatcgcctggttggcgagt
cagaatccaacgcccccggactggcaatccgcgcagcctgcagacccggcggtcagcgtc
ggtcctctgaaaccggggaatggcgccgaactcgtggccgcagtctgctccggctgccac
tccctgcatttggtgacccaacaggggctgagccgcgacagctggcaggagacactcgac
tggatgattgatgagcagggcatggcaccgctcccggaagatgacctgcagcgcgtactc
gactacctggccgcgcattacggtctggagtaa

DBGET integrated database retrieval system