KEGG   Ferrimonas balearica: Fbal_0807Help
Entry
Fbal_0807         CDS       T01318                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
fbl  Ferrimonas balearica
Pathway
fbl01100  Metabolic pathways
fbl01120  Microbial metabolism in diverse environments
fbl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fbal_0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C1 Dehyd-heme_bind
Motif
Other DBs
NCBI-ProteinID: ADN75016
JGI: Fbal_0807
UniProt: E1SSH6
Position
complement(888915..889547)
Genome map
AA seq 210 aa AA seqDB search
MHNRTLVTLALLGLLGGGVSQAVAEATPPQALACTACHQVGPDAKPAIGPPLWGLAERGI
ASYPGFEYSDALKQHQGQWNAERLDRFLADPNGFAPGTKMVFAGVPDPASRAVLIAWLAS
QNPTPPDWQSAQPADPAVSVGPLKPGNGAELVAAVCSGCHSLHLVTQQGLSRDSWQETLD
WMIDEQGMAPLPEDDLQRVLDYLAAHYGLE
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacagaacccttgtcactctggccctgttggggctgcttgggggaggcgtcagt
caagcggtggcggaagcgactccccctcaagcactggcgtgtaccgcctgtcatcaggtg
ggccccgatgccaaacccgccatcggaccgccgctctgggggctggctgaacgtggcatc
gcctcctatccggggtttgagtacagcgacgccctgaaacagcatcagggccagtggaac
gccgagcgactggaccgttttctggccgatcccaatggctttgctccgggcacgaagatg
gtgtttgcgggggtgcctgatcccgcctcccgcgcagtactgatcgcctggttggcgagt
cagaatccaacgcccccggactggcaatccgcgcagcctgcagacccggcggtcagcgtc
ggtcctctgaaaccggggaatggcgccgaactcgtggccgcagtctgctccggctgccac
tccctgcatttggtgacccaacaggggctgagccgcgacagctggcaggagacactcgac
tggatgattgatgagcagggcatggcaccgctcccggaagatgacctgcagcgcgtactc
gactacctggccgcgcattacggtctggagtaa

DBGET integrated database retrieval system