KEGG   Ferrimonas balearica: Fbal_1086Help
Entry
Fbal_1086         CDS       T01318                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fbl  Ferrimonas balearica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Fbal_1086
   00052 Galactose metabolism
    Fbal_1086
   00500 Starch and sucrose metabolism
    Fbal_1086
   00520 Amino sugar and nucleotide sugar metabolism
    Fbal_1086
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Fbal_1086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1190156..1191043
Genome map
AA seq 295 aa AA seqDB search
MSLKKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVNECVAAGFKEIILVTHASK
NAIENHFDTSFELEATLEKRVKRQLLDAVQSICPKDVTIMHVRQGIAKGLGHAILCAQPL
VGDSPFAVVLPDVILDEYTADQACENLAAMKARFEATRHSQVMVEPVPMSEVSKYGVADC
KGAELKPGESTAMTQVVEKPPVEEAPSNLAVVGRYILSEQIWSLLARTPAGAGDEIQLTD
AIAMLMEKEKVEAFHMTGKSHDCGDKLGYMKANVEYALRHPELGTAMKTHLQTLV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaaagaaagtcgttatccctgtcgccggtttgggcacccgtatgctgccagcg
actaaggccattcccaaagagatgctgccgttggtggataagccgttgattcagtacatt
gttaacgaatgcgtcgcggcgggctttaaagagatcatcctggtgacgcacgcctccaaa
aacgccatcgaaaaccacttcgataccagttttgagctggaagcgaccctggagaagcgg
gtcaagcgtcagttgctggacgcagtgcaaagcatctgtcctaaagacgtcaccatcatg
cacgtacgccagggcatcgctaagggcctggggcacgccattctctgtgctcagccgctg
gtgggcgatagcccatttgccgtggtgctgccggatgtgatcctggatgagtacactgct
gatcaggcttgcgagaatctggcggcgatgaaggcccgttttgaagccacccgtcacagc
caggtgatggtggagccggtgccgatgtccgaagtcagcaaatacggtgttgccgattgc
aaaggcgccgagctgaagcccggtgagtccaccgccatgacacaggtagtggagaagccg
ccggtggaggaagcgccttccaacctggccgtggtggggcggtatattctgtctgagcag
atttggtcattgctggcccgcaccccggccggtgccggtgatgagatccagctgaccgat
gccatcgccatgctaatggagaaagagaaggtggaagcgttccatatgaccggtaagtcc
cacgactgtggcgacaagctgggttatatgaaggccaacgtggaatacgcacttcgtcac
cctgagcttggcacggctatgaaaactcacctgcagactctggtgtaa

DBGET integrated database retrieval system