KEGG   Ferrimonas balearica: Fbal_1106Help
Entry
Fbal_1106         CDS       T01318                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fbl  Ferrimonas balearica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fbal_1106
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fbal_1106
   00052 Galactose metabolism
    Fbal_1106
   00500 Starch and sucrose metabolism
    Fbal_1106
   00520 Amino sugar and nucleotide sugar metabolism
    Fbal_1106
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fbal_1106
   00524 Butirosin and neomycin biosynthesis
    Fbal_1106
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fbal_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1220864..1221838
Genome map
AA seq 324 aa AA seqDB search
MQKNELTLLVADIGGTNARFALAHCTGAGIEVSQARHFPSADFASLEAVARHYLDTLESA
PALDGGCLAVAGPVAGERIALTNLNWYANVSELQRQLGLPRLAVINDFVAYAYSIPQLPD
SQRQVVKPGEPMAGAPRVVLGPGTGFGVASLVPTERGWLAIPCEGGHISLAATNERQAAL
VEILRRRFPHVSVETVLCGRGLVNLYQAMGQLLNLPAPLTTPAEITSAAQGGQDLLARET
LAEFCRWLGSVTADLVLAQGARGGACLGGGILPRIAEFLQHSDFTQAFGHKGLMTGYLEP
VPVELALKSDTALMGAAAWFRDHG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaacgaactgaccctgctggtggccgatattggtggcacaaacgcccggttt
gccctggcccattgcaccggggccggcattgaggtcagccaggcgcgccacttccccagt
gccgatttcgcctcactggaagcggtggctcggcactacctcgacacgctggaatcggct
ccggcactggatggtggttgtctggcagtcgctgggccggtggcgggggagcgcatcgcc
ctgaccaacctgaactggtacgccaacgtcagcgagttgcagcgtcagctggggttgccg
cgattggcggtgatcaacgattttgtcgcttacgcctactccattccgcaactgccggac
agccagcgccaggtggtgaagcccggtgagccgatggccggtgctccgcgggtagtgctc
gggccgggaaccggcttcggagtggcctcgctggtgcccaccgagcggggctggctggcg
atcccatgtgaagggggccacatcagtctggccgccaccaatgaacgtcaggcggcgctg
gtggagatcctgcggcgtcgcttcccccatgtgtcggtggaaaccgtgctgtgcgggcgc
gggctggtgaacctgtatcaggcgatggggcagctgctcaacctgccggcacccctgacc
acaccggcggagatcacctccgccgcgcagggcggccaggacctgctggcgcgggaaacg
ctggcggagttctgccggtggctgggcagcgtcacggcggacctggtgctggcccagggc
gcccggggcggcgcctgcctcggcggcggtatcctgccacgcatcgccgagttcctgcag
cacagcgactttacccaggcctttggccacaaggggctgatgaccggctatctggaaccg
gtgccggtggagttggcactgaaaagcgataccgccctgatgggggcggcggcctggttc
cgcgaccacggttga

DBGET integrated database retrieval system