KEGG   Ferrimonas balearica: Fbal_1106Help
Entry
Fbal_1106         CDS       T01318                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00010  Glycolysis / Gluconeogenesis
fbl00052  Galactose metabolism
fbl00500  Starch and sucrose metabolism
fbl00520  Amino sugar and nucleotide sugar metabolism
fbl00521  Streptomycin biosynthesis
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01120  Microbial metabolism in diverse environments
fbl01130  Biosynthesis of antibiotics
fbl01200  Carbon metabolism
Module
fbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fbal_1106
   00052 Galactose metabolism
    Fbal_1106
   00500 Starch and sucrose metabolism
    Fbal_1106
   00520 Amino sugar and nucleotide sugar metabolism
    Fbal_1106
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fbal_1106
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Fbal_1106
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fbal_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ADN75315
JGI: Fbal_1106
UniProt: E1SVG9
Position
1220864..1221838
Genome map
AA seq 324 aa AA seqDB search
MQKNELTLLVADIGGTNARFALAHCTGAGIEVSQARHFPSADFASLEAVARHYLDTLESA
PALDGGCLAVAGPVAGERIALTNLNWYANVSELQRQLGLPRLAVINDFVAYAYSIPQLPD
SQRQVVKPGEPMAGAPRVVLGPGTGFGVASLVPTERGWLAIPCEGGHISLAATNERQAAL
VEILRRRFPHVSVETVLCGRGLVNLYQAMGQLLNLPAPLTTPAEITSAAQGGQDLLARET
LAEFCRWLGSVTADLVLAQGARGGACLGGGILPRIAEFLQHSDFTQAFGHKGLMTGYLEP
VPVELALKSDTALMGAAAWFRDHG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaacgaactgaccctgctggtggccgatattggtggcacaaacgcccggttt
gccctggcccattgcaccggggccggcattgaggtcagccaggcgcgccacttccccagt
gccgatttcgcctcactggaagcggtggctcggcactacctcgacacgctggaatcggct
ccggcactggatggtggttgtctggcagtcgctgggccggtggcgggggagcgcatcgcc
ctgaccaacctgaactggtacgccaacgtcagcgagttgcagcgtcagctggggttgccg
cgattggcggtgatcaacgattttgtcgcttacgcctactccattccgcaactgccggac
agccagcgccaggtggtgaagcccggtgagccgatggccggtgctccgcgggtagtgctc
gggccgggaaccggcttcggagtggcctcgctggtgcccaccgagcggggctggctggcg
atcccatgtgaagggggccacatcagtctggccgccaccaatgaacgtcaggcggcgctg
gtggagatcctgcggcgtcgcttcccccatgtgtcggtggaaaccgtgctgtgcgggcgc
gggctggtgaacctgtatcaggcgatggggcagctgctcaacctgccggcacccctgacc
acaccggcggagatcacctccgccgcgcagggcggccaggacctgctggcgcgggaaacg
ctggcggagttctgccggtggctgggcagcgtcacggcggacctggtgctggcccagggc
gcccggggcggcgcctgcctcggcggcggtatcctgccacgcatcgccgagttcctgcag
cacagcgactttacccaggcctttggccacaaggggctgatgaccggctatctggaaccg
gtgccggtggagttggcactgaaaagcgataccgccctgatgggggcggcggcctggttc
cgcgaccacggttga

DBGET integrated database retrieval system