KEGG   Ferrimonas balearica: Fbal_1118Help
Entry
Fbal_1118         CDS       T01318                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00040  Pentose and glucuronate interconversions
fbl00052  Galactose metabolism
fbl00500  Starch and sucrose metabolism
fbl00520  Amino sugar and nucleotide sugar metabolism
fbl01100  Metabolic pathways
fbl01130  Biosynthesis of antibiotics
Module
fbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Fbal_1118
   00052 Galactose metabolism
    Fbal_1118
   00500 Starch and sucrose metabolism
    Fbal_1118
   00520 Amino sugar and nucleotide sugar metabolism
    Fbal_1118
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Fbal_1118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADN75327
JGI: Fbal_1118
UniProt: E1SVI1
Position
complement(1233076..1233972)
Genome map
AA seq 298 aa AA seqDB search
MKPLVQKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVNETIAAGIKEIVLVTHA
SKNSIENHFDTSFELEATLEKRVKRQLLAEVQSICPPDVTVMSVRQPEAKGLGHAILCAR
PLVGDAPFAVVLPDVLLDEASCDLSRDNLAAMVQQYERTNASQIMVEPVPMERIASYGVV
DINGHAIGPGDSAPIQAMVEKPAPSEAPSNLAVVGRYILSEAIWPLLEHTPPGAGGEIQL
TDAIEQLLLENPVHAFAMQGRSHDCGCKLGYLSANVEYALRHAELGAPLKAHLQRLLR
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctctggttcaaaaagccgtcatccccgttgccggactcggcacacgtatgctc
cccgccaccaaagcgattcccaaagagatgctgccggtggtcgacaaaccgctcatccag
tacgtcgtcaacgaaaccatcgccgctggcattaaagagatcgtgctggtcacccacgcc
agtaaaaactccatcgaaaaccactttgacacctcctttgagctggaagccacgctggaa
aagcgggtgaaacgccaactgctggccgaggtgcaatccatctgtcccccggatgtcacg
gtgatgagcgtccgccagccggaggccaaggggttagggcatgccattctgtgcgcccgt
cctctggttggggatgccccctttgccgtggtgttaccggatgtgctgctggatgaagcc
agctgcgacctgagccgcgataatctggcggccatggtgcagcagtatgaacgcaccaac
gccagccagattatggtggaaccggtaccgatggagcgcatcgccagctacggggtggtg
gacatcaacggccacgccatcggtcccggcgacagcgcgcccattcaggccatggtggaa
aagcccgccccgtccgaagccccctccaaccttgccgtggtgggccgctatatcctcagc
gaagcgatctggcccctgctggagcatactccgcccggtgccggtggtgagatccaactg
accgacgccattgagcaactgctgctggagaacccggttcacgcgtttgccatgcagggg
cgcagtcacgattgcggctgtaagctcggctacctgtccgccaacgtcgaatacgctctg
cgtcacgccgagctgggcgctccgctgaaagcacacctgcagcgactgttgcgctga

DBGET integrated database retrieval system