KEGG   Ferrimonas balearica: Fbal_1183Help
Entry
Fbal_1183         CDS       T01318                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fbl  Ferrimonas balearica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fbal_1183
DNA repair and recombination proteins [BR:fbl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fbal_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1316787..1317386
Genome map
AA seq 199 aa AA seqDB search
MKFSPRVDELIKALQCLPGVGPRSAQRMTFQLLERDRVAGTRLGEALSRAMSDVGHCQDC
RTFTEQTRCPICDNPRRAEKGQLCVVESPADLLAIESSGQYDGRYFVLMGHLSPLDGIGP
DDIGLDVLDRMLAEGPWQEIILATNPTVEGDATAQYIADMARQREIRVSRIAHGVPVGGE
LGYVDGTTLALSFSGRRDI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcagcccccgggtcgatgaactgatcaaggccctgcagtgcctgcctggggtg
gggcctcgctctgcccagcgcatgacgttccaactgctggagcgggaccgcgtggcgggc
acccgactgggcgaagcgctcagccgtgccatgagcgacgtcggccactgccaggactgc
cggaccttcaccgagcagacccgctgccccatctgtgacaacccgcgccgggccgaaaag
ggccagttgtgcgtggtggagtcaccggcagacctgctggcgatcgagtcctccggtcag
tacgacggtcgttactttgtgctgatgggccacctgtcgccgctggacggcattggcccg
gacgacatcggtctggacgtgcttgaccggatgctggcggaaggtccctggcaggagatc
atcctggccaccaacccgacggtggaaggggatgcgaccgcacaatacatcgccgatatg
gccagacagcgtgagatccgggtcagccggattgcacacggtgtgccggtgggcggtgaa
ctgggttacgtggatggcaccactctggcgctctccttcagcggcagacgcgatatctaa

DBGET integrated database retrieval system