KEGG   Ferrimonas balearica: Fbal_1244Help
Entry
Fbal_1244         CDS       T01318                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fbl  Ferrimonas balearica
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fbal_1244
Enzymes [BR:fbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Fbal_1244
Peptidases [BR:fbl01002]
 Cysteine Peptidases
  Family C44
   Fbal_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1387419..1389083)
Genome map
AA seq 554 aa AA seqDB search
MCGIFAILDLKTDPQALRQDALRLAKTLRHRGPDWSGIYADEQAILAHERLAIVDIDNGA
QPLYSPDGNLVLAVNGEIYNHRELREELSVGYAFQTGSDCEVILALYNKYGSQFLDKLNG
IFAFVLWDKARGRYLIGRDHIGIVPLYQGFDEHGNRYVASEMKALVPVCTRVEEFLPGQF
YDSDKGKAVTYYQREWRDFEAVADNPASRDELRQALEAAVKRQLMCDVPYGVLLSGGLDS
SITSALAKKYSQRRIEEDETSPAWWPQLHSFAIGLEGAPDLKAAAEVADHLGTVHHELNF
TVQEGIDALRDVIYHLETYDVTTVRAATPMYLMARMIKAMGIKMVLSGEGSDELFGGYLY
FHKAPNAQAFHEETVRKLDKLHLYDCLRANKAMAAWGVEARVPFLDKAFIDVAMRLNPEA
KLITEGRIEKQVLREAFAHYLPESVAWRQKEQFGDGVGYSWIDQLKVFADNQISDQELEN
AHFRFPYNTPDTKEAYLYRQLFAEQFPLDSAAECVPGGKSVACSTPEALAWDDSLRNITD
PSGRSVQSVHQSSY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggatcttcgccatcctggatctcaaaaccgatccgcaagcgctgcgccaggac
gccctgcgtctggccaaaaccctgcgccatcgtgggccggactggtccgggatctacgcc
gatgagcaagccatcctggcccatgaacgcctcgccatcgtcgacatcgacaatggcgcc
caaccgctctacagcccggatggcaacctggtgctggccgtcaacggcgagatctacaac
caccgtgaactgcgtgaggaactgagcgtcggttacgccttccagaccggctccgactgc
gaagtgatcctggccctctacaacaagtacggcagccagttcctcgacaagctcaacggc
atcttcgcctttgtcctgtgggacaaggcccgcggccgctacctgattggccgcgaccat
atcggcatcgttccgctctatcagggctttgatgaacacggcaaccgttacgttgcctcc
gagatgaaggcactggtgccggtctgcacccgggtggaggagttcctgccgggtcagttt
tacgacagcgacaagggcaaagccgtcacctactaccagcgcgaatggcgcgacttcgag
gcggtggccgacaaccccgccagccgggacgaactgcgccaggcactggaagccgcggtt
aagcgtcaactgatgtgtgacgtcccctatggcgtgctgctgtccggcggactggactcc
tccatcacctctgcgctggcaaagaaatattctcagcgacggattgaagaggatgaaacc
agcccggcctggtggccccaactgcacagttttgccattgggctggagggcgcgccggac
ctgaaagccgccgccgaagtggctgaccatctgggcaccgtgcaccacgaactgaacttt
accgtgcaggaggggatcgatgccctgcgcgatgtgatctaccacctggagacctacgac
gtcaccaccgtccgggctgccacgccgatgtacctgatggcgcgcatgattaaggcgatg
gggatcaagatggtgctctccggtgaggggtcagacgagctgtttggcggttacctctat
ttccataaagcccccaatgcccaggcgttccatgaagagacggtgcgcaagctcgacaag
ctgcatctgtatgactgcctgcgcgccaataaggcgatggccgcctggggtgtggaagct
cgggtgcccttcctcgacaaagcgttcatcgacgtcgccatgcgccttaaccctgaggcc
aagctgatcaccgaggggcggattgagaaacaggtgctgcgcgaagcgtttgcacactac
ctgccggaatcggtggcctggcgtcagaaggagcagtttggcgacggcgtgggctactcc
tggattgaccaactcaaagtatttgcagacaaccagatcagcgaccaggagctggagaac
gcccacttccgcttcccctacaacactccggacaccaaggaagcgtatctctaccgtcag
ctgtttgctgagcagttcccgctcgactctgcggcagagtgtgtgcccggtggcaaatcg
gtggcctgttccacgccggaagcgctggcctgggacgacagcctgcgcaacatcaccgat
ccctccggccgttcagtgcaatcggtacaccagtccagctactga

DBGET integrated database retrieval system