KEGG   Ferrimonas balearica: Fbal_1307Help
Entry
Fbal_1307         CDS       T01318                                 

Definition
DNA helicase/exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fbl  Ferrimonas balearica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fbal_1307
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Fbal_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1462852..1464882
Genome map
AA seq 676 aa AA seqDB search
MNNAPITNPDHGLWAELEHYVEQGWLRALDLALARWLAQQVPSTPESVLLAAVLTSHQLG
RGHICLDLAALLEDPDTLLSLPPAGRKADSRPADWLAGLTLAQWQATLAEAEVVDTEEAG
TAPLVLDGQRLYLRRFHRFESQVARSLLARQALRFELPDDVQARLAALFDPLKDESERAG
QTPHWQSIAAALAARSALAVISGGPGTGKTTTVVRLLALLQALKQDEQRAQGLEPTGLRI
RLAAPTGKAAARLSESLAATLGDIGEGKVAGVEAGVAKVIPTDVSTLHRLLGARPDSRFF
RHNADNPLHLDLLVVDEASMVDLEMMAALLAALPPRARLILLGDKDQLASVEAGAVLGDL
CRYAGEPRYQADTRGFLFRATGYDLDAFQGPGSDIEQQIVMLRKSHRFGADSGIGTLARA
VNAGSASEAKSVWPRFGDITQLQPASVSDAALRLLVLEGQAEGLEGTPKGYRHYLEVLSQ
GLDDNGCGPEQDAWARAVLNAFGEFQLLCAVREGEWGVSGMNERVSTILAKAGLIQSDAP
WYAGRPVMMMRNDYGLGLMNGDIGLCLPFADDMGQPVLRVVFPMPDGSLKRVLPSRLTEV
ETVFAMTVHKSQGSEFAHTAMVLPADPNPVLTRELVYTGITRARRWFTLVAPRPALLDSA
IRQRTQRASGLGERLK
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgccccgatcaccaacccggaccacggcctctgggccgagctggaacactac
gttgagcagggctggctgcgggcgctcgatctggcgttggcccgctggctggcccagcag
gtgccgtcaacgccggaatcggtgttgctggcggcggtgctgaccagccaccagctgggg
cggggccatatctgcctcgacctggccgcgctgctggaagacccggacaccctgctgtcc
ctgcctccggccgggcgtaaagcggactcccgtcccgccgactggctggccgggctgact
ctggcccaatggcaggccacgctggcagaggccgaggtggtggacaccgaggaagcgggt
acggcaccgctggtgctggatgggcagcgcctctatctgcgtcgcttccatcggtttgag
tctcaggtggcccgctcgctgctggcgcggcaggcgctgcgctttgagctgccggacgat
gtgcaggcccggctcgcagccctgtttgatccccttaaggacgaatccgagcgcgccggc
cagaccccgcactggcagagcatcgccgcggcgttggccgcccgcagtgccctggcggtg
atctccggcggccccggtaccggcaaaaccaccaccgtggtgcgactgctggcgctgttg
caggccctgaaacaggatgagcagcgggcacaagggctggaacccaccggcctgcgtatt
cgtctggcggcccccaccggcaaggccgctgcgcgcctgtcagaatctctggcggccacc
ctcggcgacattggtgagggtaaggtggccggggtggaggcgggcgtggccaaggtgatc
cccaccgacgtgtccaccctgcaccgcttgctgggggcgcgcccggattcccgtttcttc
cgccataacgccgacaacccgctccacctggacctgctggtggtggacgaagcctccatg
gtggacctggagatgatggcggcgttgctggcagcactgccgccccgggcccgtcttatc
ctgctgggggacaaagaccagctggcttcggtggaggcgggggcggtactgggtgacctg
tgccgttacgccggagaaccccgctatcaggcggacacccgcggttttctgttccgcgcc
accggctacgatctggacgccttccagggccccggcagcgacattgagcagcagatcgtg
atgctgcgaaaaagccaccgttttggtgccgattccggcatcggtacgttggcccgggcg
gtcaatgccggctccgcctcggaggccaaatcggtgtggccgcgttttggcgacatcacc
cagctgcaaccggccagcgtcagtgatgcggcgctgcgactgctggtgctggaggggcag
gctgaagggctggaaggaacgcccaaggggtaccgtcactatctggaggtgctgtctcag
gggctggacgacaacggctgtggccccgaacaggacgcctgggcccgtgctgtgcttaac
gcctttggcgagttccagctgctgtgtgcggtgcgtgaaggggagtggggcgtctccggc
atgaacgagcgggtcagcaccatcctggccaaggcggggctgatccagtccgacgccccc
tggtacgccgggcgaccggtgatgatgatgcgtaacgattatggcctggggctgatgaac
ggtgacatcggcctctgcctgccgtttgccgacgacatgggccagccggtgctgcgggtg
gtgtttcccatgcccgatggcagcctcaagcgggtattgccctcccggttgaccgaggtg
gaaaccgtgtttgccatgacggtgcacaaatcccagggcagtgagtttgcccatactgcc
atggtgctgcccgccgaccccaacccggtgctgacccgtgagctggtgtacaccggcatc
acccgggcccggcgctggtttactctggtggccccccgtccggccctgctggacagcgcc
atccggcagcgcacccagcgtgccagcgggctgggtgaacgcctgaagtaa

DBGET integrated database retrieval system