KEGG   Ferrimonas balearica: Fbal_1481Help
Entry
Fbal_1481         CDS       T01318                                 

Definition
AsmA family protein
Orthology
K07289  
AsmA protein
Organism
fbl  Ferrimonas balearica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1661020..1662852
Genome map
AA seq 610 aa AA seqDB search
MKVIKWLLLGLLTVVVVLTLYLAFFFDLNSFKGPIADKVKQATGRELVIGGDIGWSVYPT
LGLELAQVQLGNLPGEQLPPLLSVEQASVGVALLPLLKRELQVEELAVSGVHLELVTLAD
GRSSLTGLGGEGAAKPSEAAPATDSSAAAPKRWVLGHLAVNDLTIHNDNRAAGADQTLAI
KQLELARIEPERAAPLRLQVEVGDGDLAVSTQAEAMLTVSADFSRFQIDDWRQQLEAKGS
AIGAQPLALSLAWDADLNLAEQQFVVTNLEFKLADFILNGEAQANLAGVRPAFQLTAKGN
ALNLDPWLPADIADKGTDKSEPAPESAPAPQEEPDLSAMKLLDLDADLHLGALKARGIEA
EDLALKLRLNAGVLTLENASGKAFGGQLTAKASLDGTATPARYSFDQRIEHLSIQPMLKA
LADTDLLAGTGEFSLKGKGQGLTGKALNNLTATGALALEDGAVYGVNVAQMIREAEAKLK
GDFKAEVAEQKTDFSNFHTQLVIEDGTLGTPGLKIASPLLRIEGDGKVAIEPQTLDYQLV
VALVGSLEGQGGKGLDELKEIPIPLSISGPITNLSYGLDTDALLKGKLDQEKDKLEEKLK
DKLFERLGNF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgattaaatggttactgctgggtctgctgaccgtggtagtcgtactgacgctg
tatctggcgttcttcttcgatctcaacagttttaagggccccatcgccgataaggttaag
caggcgacgggacgtgagctggtgattggcggtgatattggctggtcggtttaccccaca
ctggggctggaactggcccaggtgcagctgggtaacctgcccggtgagcaactgccgccg
ctgttgagcgttgagcaggcgtcggtcggggtggcactgctgccgctgctgaagcgcgag
ctgcaggtcgaagagctggcggtttccggggtgcacctggagctggtgactctggcggac
gggcgctcaagcctgaccgggttgggcggtgaaggcgctgccaagcccagtgaggcggcc
ccggcaacggacagcagtgcggcggcgcccaagcgctgggtccttggtcaccttgcggtg
aatgacctgaccatccacaacgacaaccgcgccgccggtgcggatcagactctggccatc
aaacaactggaattggcccgcattgaaccggaacgcgccgcgccactgcgtctgcaggtt
gaagtaggggatggcgatttggccgtttccactcaggcagaagcgatgttgacagtgtct
gccgatttcagccggttccagatcgatgactggcgccagcaactggaggccaagggcagt
gcgattggcgcacaacctctggcgttgtcgctggcctgggacgcagacctgaatctggcc
gagcagcagtttgtggtgaccaacctggagttcaagctggcggactttatcctcaacggg
gaagcccaggccaacctggccggggtgcgtccagccttccaactgacggccaaaggcaat
gcgctgaatctcgacccctggctgcccgcggacattgcggacaaggggacggacaagtcg
gaaccggcacctgaatcggcccccgcgccgcaggaggagccggacctgagcgccatgaaa
ctgctggatctggatgcggacctgcacctgggcgcgctgaaagcccgcggcatcgaagcg
gaagacctggccctgaagctgcgccttaacgctggtgtgctgaccctggaaaacgccagt
ggtaaagccttcggcggccaactgaccgccaaggcgagtctggacggtactgccactccg
gcgcgctacagctttgatcaacgcatcgagcacctctccatccagcctatgctgaaagcg
ttggcggataccgatctgctggccggcaccggcgaattctcgctgaaaggcaaaggacag
gggctgaccggaaaagcactgaacaacctgaccgccaccggtgccctggcactggaggat
ggggcggtgtatggcgtcaacgtggcgcagatgatccgcgaagccgaagccaagctgaaa
ggggacttcaaagcggaggtggcggaacagaaaaccgacttctctaacttccacacccaa
ctggtgattgaagacggcaccctgggcactccgggcctgaaaatcgcgtctccactgctg
cgcattgaaggggatggtaaggtggcgattgagccacaaaccctggattaccagttggtg
gtggcgctggtgggcagcctggaagggcagggtggcaaagggctggatgagctcaaggag
atcccaatcccactgtccatctccggcccgattaccaacctctcctatggcctggatacc
gatgcgctgctgaagggcaagctggaccaggagaaggacaagctggaagagaaactgaaa
gacaaactgtttgaacgactggggaatttctga

DBGET integrated database retrieval system