KEGG   Ferrimonas balearica: Fbal_1509Help
Entry
Fbal_1509         CDS       T01318                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fbl  Ferrimonas balearica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fbal_1509
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fbal_1509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1688203..1688838
Genome map
AA seq 211 aa AA seqDB search
MNEEAKLVRDTLIARGLETPLVDSELNNEQKYARIKGLMAEVMGTLGLDLSDDSLRETPH
RIAKMYVEEIFAGLDYEQFPKLCVIDNKMGVDEMVKVKEISLVSTCEHHFVTIDGTATVA
YIPDKKVIGLSKINRIVQFFARRPQVQERLTQQVLVALQTLLGTNNVAVSIQATHYCVKA
RGVADASSYTETTALGGVFKTKAATRAEFLR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagaagccaagctggtacgggataccctgatagcccgaggacttgagacgccg
ttggtggacagcgagctgaacaacgagcagaagtacgcccgcatcaaagggctgatggcg
gaagtgatgggcacgctggggctggacctgagcgatgacagcctgcgggaaaccccccat
cgtatcgccaagatgtacgttgaggagatttttgccggtctggattacgagcagtttccg
aagctgtgcgttatcgacaacaaaatgggcgtggatgagatggttaaggtgaaggagatc
agtctggtcagcacctgtgagcaccattttgtcaccatcgacggcaccgccacggtggca
tacattcccgacaaaaaggtgattggcctgtccaagatcaaccgcatcgtgcagtttttt
gcccgccggccccaggtgcaggagcgcctgacccaacaggtgttggtggcactgcaaacc
ctgctcggcaccaataatgtggcggtctctatccaggcgacccactactgtgtgaaggcc
cgtggcgtcgctgacgccagctcctacaccgaaaccaccgcgctgggcggcgtgttcaaa
accaaggcggccacccgggcggagtttctgcgatga

DBGET integrated database retrieval system