KEGG   Ferrimonas balearica: Fbal_1712Help
Entry
Fbal_1712         CDS       T01318                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
fbl  Ferrimonas balearica
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fbal_1712
  Amino acid metabolism
   00340 Histidine metabolism
    Fbal_1712
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Fbal_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1906773..1908053)
Genome map
AA seq 426 aa AA seqDB search
MQRVIWQTLTETQKQAALSRSELVQDGAVAESVRTILARVKNEGDAGLLALTEQFDGPLG
DNWQLGPEQMAEAAGRLDEALKQAIDQAIDNIGRFHSAQQPQTLALNVANGVRCELRSEA
IERVGLYVPGGTAPLISTVLMLALPARIAGCELKVMVTPPPVNDAILYAASRCGVDTLFT
IGGAQAIAALAYGTETVPRVDKIFGPGNRFVTEAKTQVSQQGTAIDMPAGPSEVLVIADD
SANPDFVAADLLSQAEHGEDSQVMLVTNSAALADAVEQAVSRQLERLPRSAVAQVALSQS
RVILADTLEQACAISNAYAPEHLIVQTRAPRDLLPRLRAAGSIFLGPWTPESVGDYASGT
NHVLPTYGAARTASSLSLADFQRRFTVQELSQDGLNTLANAVTTLAEAEGLRAHATAVTL
RLEAQQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgggtgatttggcaaaccttaaccgaaacgcagaagcaggcggcactgagccgg
tccgaactggtgcaggatggcgccgtcgccgagtcggtgcgcaccattctggccagagtg
aagaacgaaggcgacgcggggctgctggcactgacagagcagtttgacgggccactgggg
gacaactggcagctggggccggagcagatggccgaggcggccggacgactggatgaggcg
ctgaaacaggcgatcgaccaggccatcgataacatcggtcgcttccacagcgcgcagcaa
ccccagaccctcgccctcaatgtcgccaatggcgtgcgctgcgaactgcgcagcgaagcg
attgagcgagtgggcctgtacgtccccggcggtaccgccccgctgatcagcaccgtactg
atgctggccctgcccgcccgcatcgccggctgtgaactgaaagtgatggtgaccccgcca
ccggtcaacgacgccatcctgtatgcggcctcccgctgcggcgtcgacaccctgtttacc
atcggcggtgcacaggccatcgcagccctcgcctacggcaccgaaaccgtgccccgggtc
gacaagatctttggcccgggcaaccgctttgtcaccgaagcgaaaacccaggtcagccag
cagggcaccgccatcgacatgcccgccggcccctctgaggtgctggtgatcgccgatgac
agcgccaatccggacttcgtggcggcggacctcctttctcaggccgagcacggcgaagac
tctcaggtgatgctggtgaccaacagtgccgccctggctgatgcggtggaacaagcagta
agtcgtcagctcgaacgcctgccgcggtctgctgtagcgcaagttgccctgagccagagc
cgggtgattctggccgacaccctggagcaggcctgcgccatcagcaacgcctacgccccg
gagcacctgattgtgcaaacccgggcgccccgcgacctgctgccccgcctgcgcgcggcc
ggttccatctttctgggcccctggacgccggagtccgtcggcgactacgccagcggcacc
aaccacgtgctgcccacctacggcgccgcccgtaccgcatccagcctgtccctggccgat
ttccagcgccgtttcaccgtgcaggagctgagccaggacggtttgaacaccctcgccaat
gccgtcaccaccctggctgaagcggaagggctgcgtgcccacgccactgccgtcaccctg
cgtctggaggcccagcaatga

DBGET integrated database retrieval system