KEGG   Ferrimonas balearica: Fbal_1894Help
Entry
Fbal_1894         CDS       T01318                                 

Definition
peroxiredoxin (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fbl  Ferrimonas balearica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fbl00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fbl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2125444..2125926
Genome map
AA seq 160 aa AA seqDB search
MSGNIYQFSADLNGGEPQSLEAYRGKVLLVVNTASACGFTPQYEGLQKLQNEFGERGFSV
LAFPCNQFGNQESGDDEAIRGFCDLRFNIDFPLFSKIDVNGNNAHPLFEWLKAEKGGWLG
DNIKWNFTKFLVDREGRVVERFAPTTKPESIAGAIEKLLA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggaacatctaccaattcagtgccgacctcaacggcggcgagccccaatccttg
gaagcctatcgcggcaaagtgctcctggtggtcaatactgccagtgcgtgcggttttacg
ccccagtatgaaggcctgcagaagttgcaaaacgagtttggcgagcgtggcttctcggtg
ttggcctttccgtgtaaccagtttggcaatcaggaatccggagacgacgaggcgatccgt
ggcttttgcgatttgcgcttcaatatcgactttccgctgttttccaaaatcgacgtgaac
ggcaacaacgcgcaccccttatttgagtggcttaaagcggagaagggcggttggctgggc
gacaacatcaagtggaacttcactaagtttctggtggacagagaggggcgggtggttgaa
cgatttgcgccgacgaccaaacctgagtcgatcgccggcgccattgagaagctgttagct
tag

DBGET integrated database retrieval system