KEGG   Ferrimonas balearica: Fbal_2005Help
Entry
Fbal_2005         CDS       T01318                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fbl  Ferrimonas balearica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fbal_2005
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Fbal_2005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2244189..2244812)
Genome map
AA seq 207 aa AA seqDB search
MIGRLRGLLVEKAAPEVVLECGGVGYEVQLPMTSFYQLPELGSEAVIFTHFVVREDAQLL
YGFASKEERALFRELIKTNGVGPKMALGILSGMSAEQFVDAVQAENITGLTKLPGVGKKT
AERLVVEMRDRLKNFGGPLLTPYADRLAGTNPTENTLVSAPDPEEDAIAALVALGYKAPA
ASKVVAKVAAPGMSSEQLIRDALKAML
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtgattggacgcctgcgtggactgttggtagagaaagcggcaccggaagtggtgctggag
tgtggcggcgttggttacgaggtgcaattgccgatgaccagcttctaccaactgccggag
ctgggcagcgaagcggtcatctttactcacttcgtggtgcgggaagacgctcaactgctc
tatgggtttgcttctaaagaggagcgggccctgtttcgcgagctgatcaaaaccaatggt
gtggggccgaaaatggccctgggcatcctgtccggcatgtccgccgagcagtttgttgat
gcggtgcaggcggagaacatcaccggcctgaccaagctgccgggcgtgggtaagaaaacc
gctgaacgcctggtggtggagatgcgtgaccgactgaagaatttcggtggcccgctgctg
accccctatgccgaccgccttgccggtaccaacccgacggagaacaccttggtgtctgcg
ccggacccggaagaggatgccattgccgcgctggtggccctgggctacaaagcaccggcc
gccagtaaggtggtcgccaaggtcgcggcaccggggatgagctcggagcagctgatccgc
gatgcactgaaagcgatgctgtga

DBGET integrated database retrieval system