KEGG   Ferrimonas balearica: Fbal_2490Help
Entry
Fbal_2490         CDS       T01318                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fbl  Ferrimonas balearica
Pathway
fbl00020  Citrate cycle (TCA cycle)
fbl00190  Oxidative phosphorylation
fbl00650  Butanoate metabolism
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01120  Microbial metabolism in diverse environments
fbl01130  Biosynthesis of antibiotics
fbl01200  Carbon metabolism
Module
fbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fbl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fbal_2490
   00650 Butanoate metabolism
    Fbal_2490
  Energy metabolism
   00190 Oxidative phosphorylation
    Fbal_2490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADN76692
JGI: Fbal_2490
UniProt: E1SNL9
Position
complement(2772172..2772519)
Genome map
AA seq 115 aa AA seqDB search
MVKNAATLGRSGVHDFVLLRASALVLASFVLFMVGFLALTPELTFESWHGLFSHTAMKVY
TLVSLVALLVHGWIGLWQVLTDYIKPAGLRAFLQFAVNLVLLAYLFAGVVILWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaatgccgcgactctcggacgcagcggcgtccacgattttgtcctgctgcgc
gccagtgctctggttctggccagcttcgtcctctttatggttggtttcctggcgctcact
ccggagctgacctttgaaagctggcacggcctgttttcccataccgccatgaaggtgtac
accctggtcagcctggtcgccctgttggtgcatggctggattggcctgtggcaggtactg
accgattacatcaagccggcgggcctgcgtgccttcctgcaatttgcggtcaatctggtt
ctgctggcctacctgtttgccggcgttgtgatcctgtggggtgtgtaa

DBGET integrated database retrieval system