KEGG   Ferrimonas balearica: Fbal_2539Help
Entry
Fbal_2539         CDS       T01318                                 

Definition
phosphoribosylanthranilate isomerase ;indole-3-glycerol phosphate synthase (EC:4.1.1.48 5.3.1.24)
Orthology
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
fbl  Ferrimonas balearica
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fbal_2539
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fbal_2539
Enzymes [BR:fbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Fbal_2539
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Fbal_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2837946..2839322
Genome map
AA seq 458 aa AA seqDB search
MSLAGIKHTDTVLDRIVATKPAQIEALTARYGDLLERRAAPSQRSLFDALKQGPTGFILE
CKKASPSKGLIRADFDPVAIARIYNHYAAAISVLTDEQFFQGDFEYLRAVCQNVDVPVLC
KDFIVDVRQLRLARHLGADAALLMLSVLDDPLYQTLAEEADALGLDVLTEVSNQEEMDRA
IALNARIIGINNRDLRDLSIDLATTERLAGQVPKDRVVISESGIYRHDQVRRLAPHADAF
LVGSSLTEQANIDLACRRLIYGPTKVCGLTRPDDARAAAEAGASYGGLIFAAKSPRCVSL
ERAQQVRQAADLDYVGVFVNEDPARVAAVAEHLGLHAVQLHGSEDDAYINDLRPRLSGTA
IWKAVKPDGSNAVSNADRLLFDSAKGSQFGGTGCVFDWASVGSERADAMLAGGLGPDNVA
DAARAGFYGLDINSGVEDAPGIKNADKIRTSLTAVRQY
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagccttgccggaatcaaacacaccgacaccgtattggatcgcatcgtggccaccaag
ccggcccagattgaggcgcttaccgcccgctacggtgatctgctggagcgccgcgcggcc
ccctcacaacgcagcctgttcgacgcgctcaagcagggccccaccggctttattcttgag
tgcaaaaaggccagcccctccaagggtctgatccgcgccgacttcgacccggtggccatc
gcccgcatctacaaccactacgcggcggccatttcggtgctgaccgatgagcagttcttt
cagggcgactttgaatacctgcgcgcggtatgccagaacgtcgatgtgccggtgctgtgc
aaagactttattgtcgatgtccgccagctgcgcctggcccgccacctcggcgccgacgcg
gccctgctgatgctgtccgtactcgatgaccccctctaccagaccctggctgaagaagcc
gacgcactggggctggatgtgctgactgaggtcagcaatcaggaggagatggaccgggcc
atcgccctgaacgcccgcattatcggcatcaacaaccgtgacctgcgcgacctctccatc
gatctggccaccaccgagcgcctggcaggccaggtgccaaaagaccgggtggtgatcagc
gagtccggcatctaccgccatgatcaggtgcgtcgactggcgccccatgcggatgccttc
ctggtgggcagcagcctgaccgaacaggccaatatcgatcttgcctgccgccgcctgatc
tacggccccactaaggtgtgtgggctgacccgccctgacgacgcccgcgccgccgccgag
gcgggtgccagttacggtggcctgatcttcgccgccaagtccccccgttgtgtcagcctg
gagcgggctcaacaggtgcgtcaggccgccgacctcgattacgtcggggtgttcgtcaat
gaagacccagcccgggtggcggccgtggcggaacacctcggtctgcacgcggtgcagctg
cacggcagtgaagatgacgcctacatcaatgacctgcgcccccggttaagcggcaccgcc
atctggaaagcggtgaagcccgatggcagtaatgcggtcagcaacgccgaccgactgctg
ttcgacagcgctaagggcagccagtttggcggcaccggctgcgtatttgactgggccagt
gtgggcagcgaacgcgccgacgccatgctggccggcggccttggaccggacaacgtggcc
gatgccgcccgggccggtttctacggactggacatcaactccggtgtggaagacgcaccg
ggcatcaagaacgccgacaaaatcagaaccagcctgaccgcagtacgccagtactga

DBGET integrated database retrieval system