KEGG   Ferrimonas balearica: Fbal_2540Help
Entry
Fbal_2540         CDS       T01318                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fbl  Ferrimonas balearica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fbal_2540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fbal_2540
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fbal_2540
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fbal_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2839350..2840537
Genome map
AA seq 395 aa AA seqDB search
MTILNPYFGEFGGQYVSQILVPALNQLEAAFVEAQQDPDFQREFTGLLKEYAGRPTALTL
TRNFSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKNEIIAETGAGQHGVASAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSANY
DKAHYLLGTAAGPHPFPTIVREFQRMIGEETKAQILQKEGRLPDAVIACVGGGSNAIGMF
ADFIEETSVKLIGVEPAGHGIESGEHGAPLAHGKLGIFFGMKAPLMQNEHGQIEESYSVS
AGLDFPSVGPQHAHLAATGRAQYPSITDDEALEAFQRLARTEGIIPALESAHALAHAYKM
AEQATEETLLVVNLSGRGDKDIFTVHDILEKEGKL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaccattctcaacccctacttcggtgaatttggcggccagtacgtgtcgcagatcctg
gtgccggcacttaaccagctggaagccgcctttgttgaggcacaacaggatcccgacttt
cagcgcgagttcaccggactgctgaaagagtacgccggccgtcccactgccctgaccctg
acccgcaacttcagccccaacccgctggtgaagatctacctcaagcgggaagacctgctg
catggcggcgcccacaagaccaaccaggtactgggtcaggccctgttggccaagcgcatg
ggcaaaaacgagatcatcgccgaaaccggcgccggtcagcacggtgtggccagcgccctg
gcctgcgccctgttgggcctgaagtgccgggtgtacatgggcgccaaagacgtggagcgt
caaagccccaatgtgttccggatgcgcctgatgggtgccgaggtgattccggtgcactca
ggttccgccaccctcaaagacgcctgtaacgaggccctgcgtgactggagcgccaactac
gacaaggcccactacctgctcggcaccgccgcaggcccgcaccccttccccaccattgtg
cgcgagttccaacgcatgatcggtgaagaaaccaaggcccagatcctgcaaaaagagggg
cgcctgccggacgccgttatcgcctgtgtgggcggtggctccaatgccatcggcatgttc
gccgactttatcgaggaaacctcggtcaagctgatcggcgttgagccggcgggccacggt
attgagtctggtgagcacggcgcaccgctggctcacggcaagctcggcatcttctttggt
atgaaagcgccactgatgcagaacgaacacggtcagattgaagagtcctattcggtctct
gccggtctggacttcccgtccgtcgggccgcagcacgcccatctggccgccaccggtcgt
gcccagtacccgtccatcaccgatgacgaagcactggaagcgttccagcgtctggcccgc
actgaggggatcatcccggcgctggaatccgcccacgccctggcccacgcctacaagatg
gctgagcaggccaccgaagagacgctgctggtggtgaacctgtccggccgcggcgacaaa
gacatctttactgttcacgatattctggagaaggaaggcaagctatga

DBGET integrated database retrieval system