KEGG   Ferrimonas balearica: Fbal_2541Help
Entry
Fbal_2541         CDS       T01318                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fbl  Ferrimonas balearica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fbal_2541
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fbal_2541
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fbal_2541
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fbal_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2840534..2841337
Genome map
AA seq 267 aa AA seqDB search
MSRYQRLFDTLSARGEGAFVPFVTLGDPNPGDSLAVIEALIAGGADALELGFPFSDPAAD
GPTIQDANIRALNAGTTPGHCFEILAQIRQRHPDLPIGLLVYANLVFSPGLDTFYRRCAE
VGVDSVLVADVPVQEATPFIEAAKAHGVAPIFIAPPNADDATLQAVAEAGQGYTYLLSRA
GVTGTETAAGMPVDHLLEALKRFGAPPAVLGFGIAEPSQVKSAIDAGAAGAISGSAVVKL
IAQHQHDRAALTQALTDFVQGMKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctaccaacgcctgtttgataccctgtccgcgcgcggcgaaggcgcctttgtg
ccgtttgtgaccctgggcgatcccaaccccggtgacagcctggcggtgattgaagccctg
atcgccggcggcgccgacgcgttggagctgggcttccccttctctgaccccgccgccgat
ggccccaccattcaggacgccaatatccgtgccctgaacgccggcaccactccgggccac
tgctttgagattctggcccagatccgccagcgtcacccggacctgcccatcggcctgctg
gtgtacgccaacctggtgttttcgccgggactggacaccttctaccgccgttgtgccgaa
gtgggggtggattcggtgctggtggccgatgtgccggtgcaggaagctacgccctttatt
gaagccgccaaagcccacggcgtggcgccgatctttatcgccccgcccaatgccgacgac
gccaccctgcaagcggtggccgaagcgggccagggttacacctacctgctgtcccgcgca
ggggtgaccggcaccgaaaccgccgccggcatgccggtggaccacctgctggaggccctc
aagcgttttggtgcgccgccagcggtactgggctttggcatcgccgagccgagccaggtg
aagagtgccattgatgctggcgccgccggggccatctccggctctgcggtggtcaagctg
attgcccagcaccagcatgaccgcgccgctctgacccaggccctgaccgactttgtgcaa
gggatgaaagcggccacccgctaa

DBGET integrated database retrieval system