KEGG   Ferrimonas balearica: Fbal_2570Help
Entry
Fbal_2570         CDS       T01318                                 

Definition
lysophospholipase (EC:3.1.1.2 3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
fbl  Ferrimonas balearica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Fbal_2570
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Fbal_2570
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Fbal_2570
Lipid biosynthesis proteins [BR:fbl01004]
 Fatty acid synthase
  Component type
   Fbal_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2867967..2868569
Genome map
AA seq 200 aa AA seqDB search
MVRRSLLILMLCLYQPGAWADQPSILILGDSLSASYGMSEAEGWVKKLQQNLPDAQIINA
SVSGETSGGGLRRLPGLLQQHQPDWVFVELGGNDGLRGFQPTITENNIEQLITLSKASGA
QVLLSEVMVPPNYGRRYAERFQQIYHGLAKEHEVELVPFFMTEIATDPNLMQADGIHPNR
EAQGRIAAFLLPWFEQAIAE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggcgatccttgctgattttgatgttgtgtttataccagcccggagcgtgggcc
gatcagccttccattctaatactgggagacagcctcagtgcaagctacggaatgagtgaa
gcggaaggttgggtaaaaaaattgcaacaaaatctgcccgatgcccagatcatcaacgcc
tccgtcagtggtgaaaccagtggtggcgggttgagacgactgccgggtctgctacaacag
catcagccggattgggtgtttgtggagttgggggggaatgacggcttgcgtggctttcag
cccaccatcaccgagaacaatatcgagcagctgattaccctcagcaaagcgtcaggcgcc
caggtgttgctttccgaagttatggtgccacccaactacggccgccgatacgcggagcgt
ttccagcagatctatcatggactggcgaaggaacacgaggtggaactggtgcccttcttt
atgactgagatcgccaccgaccccaacctgatgcaggccgatggcatccaccccaaccgg
gaagcacaaggtcggatcgccgccttcctgctgccctggtttgaacaggcgattgccgag
taa

DBGET integrated database retrieval system