KEGG   Ferrimonas balearica: Fbal_2784Help
Entry
Fbal_2784         CDS       T01318                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00630  Glyoxylate and dicarboxylate metabolism
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01120  Microbial metabolism in diverse environments
fbl01200  Carbon metabolism
Module
fbl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Fbal_2784
Enzymes [BR:fbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Fbal_2784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADN76986
JGI: Fbal_2784
UniProt: E1SRR5
Position
complement(3119481..3121073)
Genome map
AA seq 530 aa AA seqDB search
MATYQNDIDTANSLIETQGQTWGVNAENVARMKAQNRFKTGLDIARYTAAIMRQDMAAYD
ADPTQYTQSLGCWHGFIGQQKLIAIKKHLESTKGRYLYLSGWMVAALRSEFGPLPDQSMH
EKTSVAALIEELYTFLRQADARELGGYFRALDAAREAGDKAKEAEVQAQIDNFQTHVVPI
IADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLAKIR
AVRYAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDQYNSYLDGEYVESADDIA
NGDVVVKANGKLLKPSRLASGLFQFRKGSGEDRVVLDCITSLQHGADLLWIETEKPHVGQ
IAGMVNRIREVIPNAKLVYNNSPSFNWTLNFRQQVFDAWEAAGRDLSAYDRTNLMSAQYD
DTELAVEADDKIRSFQADAAREAGIFHHLITLPTYHTAALSTDNLAKGYFGDQGMLAYVS
GVQRKEIRQGIACVRHQNMAGSDMGDDHKEYFSGDAALKAAGKDNTMNQF
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggccacttaccaaaacgacattgataccgccaacagcttgattgaaacccaggggcaa
acgtggggggtaaacgccgagaacgtcgcgcgcatgaaggcgcagaaccgtttcaaaacc
ggccttgatattgcccgttacaccgctgcgatcatgcgccaggatatggccgcctatgac
gctgacccgactcagtacacccagtccctgggctgctggcacggctttatcggtcagcag
aagctgatcgccatcaagaagcatctggaaagcaccaagggtcgctacctgtacctgtcc
ggctggatggtggcggcgctgcgcagtgagttcggcccgctgccggaccagtccatgcat
gagaagacctctgtggccgcgctgattgaagagctgtacaccttcctgcgccaggcggac
gctcgcgagctgggcggttacttccgtgcgctggatgcggcccgtgaggctggcgataag
gccaaagaagccgaagtgcaggcgcagatcgacaacttccagacccacgtggtgccgatc
attgccgacatcgatgccggttttggtaacgaagaggccacctacctgttggccaagaag
atgattgaagccggcgcctgctgcatccagatcgaaaaccaggtgtccgacgagaagcag
tgtggtcaccaggacggtaaggtcaccgtgccccacgccgacttcctcgccaagatccgc
gccgttcgctacgccttcctggagctgggggtggatgacggtgttatcgttgcccgtacc
gactccctgggtgccggcctgaccaagcagattgcggtcaccaacgagccgggcgatctg
ggcgaccagtacaacagctacctcgacggtgagtacgtcgagagcgctgacgacatcgcc
aacggtgatgtggtggtgaaggccaacggcaaactgctgaagccttcccgtctggccagt
ggcctgttccagttccgcaaaggttccggtgaagaccgggtggtgctggactgcatcacc
tctttgcagcacggcgctgacctgctgtggattgaaaccgagaagccgcacgttggccag
attgccgggatggttaatcgcatccgcgaggtgatccccaatgcaaagctggtttacaac
aacagcccctccttcaactggaccctgaacttccgtcagcaggtgttcgatgcctgggaa
gcggccggccgcgacctgtccgcttacgaccgcaccaacctgatgagtgcccagtacgat
gacactgaactggcggtggaagccgatgacaagatccgctccttccaggccgatgcggcg
cgcgaagctggcatcttccaccacctgattaccctgccgacctaccacaccgcggcactg
tccaccgacaacctggccaaaggctacttcggtgaccaaggcatgctggcttacgtgtcc
ggggtacagcgtaaggagatccgtcagggtatcgcctgcgtgagacaccagaacatggcc
ggttccgacatgggtgatgatcacaaggagtacttctccggtgacgcggcgctgaaagca
gccggtaaagacaacaccatgaaccagttctaa

DBGET integrated database retrieval system