KEGG   Ferrimonas balearica: Fbal_2785Help
Entry
Fbal_2785         CDS       T01318                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fbl  Ferrimonas balearica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:fbl01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:fbl00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:fbl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3121088..3122725)
Genome map
AA seq 545 aa AA seqDB search
MSQAVIESKDRIIKRGQFVAGEDQVLSAEALGFLAELAERFAAPRQTLLQARLQKQAEID
AGKLPDFLPETRNVREGNWQILGIPADLQDRRVEITGPVDRKMVINALNADVKVFMADFE
DSLAPSWEKVVQGQQNLKDAVDGTIEYTNPANGKEYRLNPDPAVLIARVRGLHLDEAHLT
YQGEPLPGALVDFALYFYHNYRALLAKGSGPYFYIPKLQSHLEARWWAEVFAYTEERFCL
TPGTIKATCLIETLPAVFEMDEILYELRNNIVGLNCGRWDYIFSYIKTLKNYPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPERQAQVLAKVQQDKELEAR
NGHDGTWIAHPGLADTAMAVMNEYIGDRPNQLQVSRDVDAPITAEDLLAPCEGQATEAGM
RANIRIAVQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIKHGTHLDNGQLVTADL
FRTLLKEELSVVREELGAERFDGGRFDEAATIFERLTCADQLTDFLTLPGYQILTQSTLA
HGQAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcagtcattgagtcgaaagaccgcattattaagcgtggccagttcgtggcc
ggcgaagatcaggtgctgagcgccgaggcgctggggtttctggccgagctggccgagcgc
tttgccgcgccaagacaaaccctgctgcaggcccgcctgcaaaagcaggccgagattgat
gccggcaaactgccggactttctgccggaaacccgcaatgtgcgggaaggcaactggcag
atcctgggcattccggcagacctgcaggaccgccgggtcgagatcaccggtccagtggac
cgcaagatggtgatcaatgccctgaatgccgacgtcaaagtgtttatggcggactttgag
gactcactggcgcccagctgggagaaggtggtccagggtcagcagaacctgaaagacgcg
gtggatggcaccatcgaatacaccaatccggccaatggcaaagagtatcgactcaacccc
gacccggccgtgttgatcgcccgggtacgtgggctgcacctggatgaagcccacctgacc
tatcagggggagccgctgcccggcgctctggtggatttcgccctctacttctaccacaac
tatcgcgccttgctggcgaagggttctggtccctacttctacattcccaagctgcaaagt
caccttgaggcgcgttggtgggccgaagtgttcgcttacaccgaagagcgtttctgcctg
actcccggcaccatcaaggccacctgcctgatcgaaaccctgccggcggtgtttgagatg
gatgagatcctctacgagctgcgtaacaacatcgtggggctgaactgcggacgctgggac
tacatcttcagctacatcaagaccttgaagaactacccggatcgggtgctgccggatcgt
caggtggtcaccatggataagccgttcctgtccgcctactcccgactgctgattaagacc
tgtcacaagcgtggtgcgctggcgatgggcggcatggcggcctttattcctgccaaagac
ccggagcgtcaggcacaggtgctggccaaagtgcagcaggacaaggagctggaagcccgt
aacggtcacgacggcacctggatcgcccaccccggcctggcggacaccgccatggcggtg
atgaacgagtacatcggcgaccgccccaaccagcttcaggtatcccgtgatgtggatgcc
cccatcaccgctgaggatttgctggcaccctgtgagggccaggccaccgaagcgggcatg
cgcgccaacattcgcatcgccgtgcagtacatcgaagcctggatctccggcaatggctgc
gttccgatttatggcctgatggaggacgccgccacggcggagatctcccgggcttccatc
tggcaatggattaagcacggcacccatctggacaatggccagctggtgaccgccgatctg
ttccgcaccctgctcaaggaggagctcagcgtggttcgtgaggagctgggggcagagcgc
tttgacggcggacggtttgatgaagccgccaccatcttcgagcgcctgacctgtgccgat
caattgaccgatttcctgaccctgcccgggtaccagatcctgacccaatccacccttgct
catggacaagcactgtaa

DBGET integrated database retrieval system