KEGG   Ferrimonas balearica: Fbal_2785Help
Entry
Fbal_2785         CDS       T01318                                 

Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
fbl  Ferrimonas balearica
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fbal_2785
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fbal_2785
   00630 Glyoxylate and dicarboxylate metabolism
    Fbal_2785
Enzymes [BR:fbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fbal_2785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3121088..3122725)
Genome map
AA seq 545 aa AA seqDB search
MSQAVIESKDRIIKRGQFVAGEDQVLSAEALGFLAELAERFAAPRQTLLQARLQKQAEID
AGKLPDFLPETRNVREGNWQILGIPADLQDRRVEITGPVDRKMVINALNADVKVFMADFE
DSLAPSWEKVVQGQQNLKDAVDGTIEYTNPANGKEYRLNPDPAVLIARVRGLHLDEAHLT
YQGEPLPGALVDFALYFYHNYRALLAKGSGPYFYIPKLQSHLEARWWAEVFAYTEERFCL
TPGTIKATCLIETLPAVFEMDEILYELRNNIVGLNCGRWDYIFSYIKTLKNYPDRVLPDR
QVVTMDKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPERQAQVLAKVQQDKELEAR
NGHDGTWIAHPGLADTAMAVMNEYIGDRPNQLQVSRDVDAPITAEDLLAPCEGQATEAGM
RANIRIAVQYIEAWISGNGCVPIYGLMEDAATAEISRASIWQWIKHGTHLDNGQLVTADL
FRTLLKEELSVVREELGAERFDGGRFDEAATIFERLTCADQLTDFLTLPGYQILTQSTLA
HGQAL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggcagtcattgagtcgaaagaccgcattattaagcgtggccagttcgtggcc
ggcgaagatcaggtgctgagcgccgaggcgctggggtttctggccgagctggccgagcgc
tttgccgcgccaagacaaaccctgctgcaggcccgcctgcaaaagcaggccgagattgat
gccggcaaactgccggactttctgccggaaacccgcaatgtgcgggaaggcaactggcag
atcctgggcattccggcagacctgcaggaccgccgggtcgagatcaccggtccagtggac
cgcaagatggtgatcaatgccctgaatgccgacgtcaaagtgtttatggcggactttgag
gactcactggcgcccagctgggagaaggtggtccagggtcagcagaacctgaaagacgcg
gtggatggcaccatcgaatacaccaatccggccaatggcaaagagtatcgactcaacccc
gacccggccgtgttgatcgcccgggtacgtgggctgcacctggatgaagcccacctgacc
tatcagggggagccgctgcccggcgctctggtggatttcgccctctacttctaccacaac
tatcgcgccttgctggcgaagggttctggtccctacttctacattcccaagctgcaaagt
caccttgaggcgcgttggtgggccgaagtgttcgcttacaccgaagagcgtttctgcctg
actcccggcaccatcaaggccacctgcctgatcgaaaccctgccggcggtgtttgagatg
gatgagatcctctacgagctgcgtaacaacatcgtggggctgaactgcggacgctgggac
tacatcttcagctacatcaagaccttgaagaactacccggatcgggtgctgccggatcgt
caggtggtcaccatggataagccgttcctgtccgcctactcccgactgctgattaagacc
tgtcacaagcgtggtgcgctggcgatgggcggcatggcggcctttattcctgccaaagac
ccggagcgtcaggcacaggtgctggccaaagtgcagcaggacaaggagctggaagcccgt
aacggtcacgacggcacctggatcgcccaccccggcctggcggacaccgccatggcggtg
atgaacgagtacatcggcgaccgccccaaccagcttcaggtatcccgtgatgtggatgcc
cccatcaccgctgaggatttgctggcaccctgtgagggccaggccaccgaagcgggcatg
cgcgccaacattcgcatcgccgtgcagtacatcgaagcctggatctccggcaatggctgc
gttccgatttatggcctgatggaggacgccgccacggcggagatctcccgggcttccatc
tggcaatggattaagcacggcacccatctggacaatggccagctggtgaccgccgatctg
ttccgcaccctgctcaaggaggagctcagcgtggttcgtgaggagctgggggcagagcgc
tttgacggcggacggtttgatgaagccgccaccatcttcgagcgcctgacctgtgccgat
caattgaccgatttcctgaccctgcccgggtaccagatcctgacccaatccacccttgct
catggacaagcactgtaa

DBGET integrated database retrieval system