KEGG   Ferrimonas balearica: Fbal_2828Help
Entry
Fbal_2828         CDS       T01318                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00900  Terpenoid backbone biosynthesis
fbl01100  Metabolic pathways
fbl01110  Biosynthesis of secondary metabolites
fbl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fbal_2828
Enzymes [BR:fbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Fbal_2828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADN77030
JGI: Fbal_2828
UniProt: E1SS98
Position
3175178..3176020
Genome map
AA seq 280 aa AA seqDB search
MSSSAAWPAPAKLNLCLHINGRRPDGYHELQTLFQFVDFADQLHFDITDDGVIALTPAIP
GVAHDDNLIVRAARRLQAHTGTHKGARIHLDKRLPMGGGLGGGSSDAATTLVALNHLWNT
GVDEDTLADLGLALGADVPVFVRGRAAMADGVGEKLRPVNVEEPWYLVVVPDVEVSTAEV
FGHPDLTRDSAKITALETQPERWHNDCQKVVCEAYPQVAKALSWLVEYAPSKMTGTGSCV
FGRFDQQQQAQAALEQLPAEWQGFVARGCNLSPLQAKLGQ
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagcgccgcctggccagccccggccaaactgaatctctgcctgcacattaat
ggtcgtcgtcccgacggctatcacgagctgcagaccctgtttcaatttgtcgactttgcc
gaccagctccatttcgacatcaccgacgacggtgtgattgcgctgacgccggccattccc
ggtgtggcccacgatgacaacctgattgtccgtgccgcccgccgcctgcaggcccacacc
ggcacccataaaggcgcacgcatccatctggacaaacgcctgccgatgggcggggggcta
ggcggggggtcctccgatgcagccaccaccctggtggcgttgaaccatctgtggaacacc
ggtgtggatgaagacaccctggcggatttgggcctggccctgggcgccgatgtgccggtg
ttcgtgcgtggccgtgctgccatggccgacggcgttggtgaaaagttgcgcccggtaaat
gttgaagagccttggtacctggtggtcgtaccagatgtcgaagtgagcacagcggaagtc
tttggtcacccggacctgacccgcgacagcgccaagatcacagcattggaaacccagccg
gaacgctggcacaacgactgccagaaggtggtgtgtgaagcctacccccaagttgcaaag
gcgctgagctggttggtagaatacgcgccgtcaaaaatgaccggtaccggcagctgtgtg
tttggtcgattcgaccaacaacaacaggcgcaggccgcgctcgagcaactccccgccgaa
tggcagggattcgttgcccggggctgcaacctgtcgccgctgcaggctaaactgggtcag
taa

DBGET integrated database retrieval system