KEGG   Ferrimonas balearica: Fbal_2856Help
Entry
Fbal_2856         CDS       T01318                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00240  Pyrimidine metabolism
fbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Fbal_2856
Enzymes [BR:fbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Fbal_2856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: ADN77058
JGI: Fbal_2856
UniProt: E1SSQ4
Position
complement(3212279..3213610)
Genome map
AA seq 443 aa AA seqDB search
MFLPQEIIRKKRDGLELSAEEIRFFVQGIADNSVSEGQIAAFAMAVFFNDMTMAERVALT
TGMRDSGDVLNWDHLNLDGPILDKHSTGGVGDVVSLMLGPMIAACGAYVPMISGRGLGHT
GGTLDKLESIPGYNIVPDNQRFGEVVKSAGVAIIGQTGALAPADKRFYATRDVTATVDSI
SLITASILSKKLAAGLDALVMDVKVGSGAFMPTYEASEQLAQCIVEVANGAGVPTSALLT
DMNQVLASSAGNAVEVREAVKFLTGTQRNPRLHRVTLSLGAELLVLGKLARDPEHAWQML
EKTLSDGSAAERFGRMVAGLGGPADFMDNPDRFLPKAKVVRPVYPDRKGIVTAMDTRAIG
MAVVNMGGGRKVASDSIDHSVGFDNLCVLRQSVDEQTPLAMLHANDDAQWQAGADALRNA
ITLGDSAPAADPEVYRLVRDANR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgccgcaagagatcattcgaaaaaaacgcgatggcctggagctgagcgcggaa
gagatccgcttcttcgtccagggcattgctgacaacagcgtcagcgagggccagattgcg
gcctttgccatggcggtgttcttcaacgacatgaccatggctgagcgcgttgcgctgacc
accggcatgcgtgactccggcgacgtgctgaactgggaccacctcaatctggatggcccc
atcctcgataagcactccaccggcggcgttggcgatgtggtatcgctgatgctgggcccc
atgattgccgcctgcggcgcctacgtgccgatgatttccggccgtggtctgggccatacc
ggcggcacgctggataagctcgaatccattcccggctacaacatcgtgccggacaaccaa
cgctttggcgaggtggtaaaatccgccggtgtggccatcattggccaaaccggggcactg
gcccccgctgacaagcgcttctacgccacccgcgacgtgaccgccacggtcgactccatc
tccctgattaccgcctccattctgtccaagaagctggccgctggcctggatgccctggtg
atggacgttaaagtgggcagtggtgcctttatgcccacctacgaggcctctgagcagttg
gctcagtgcatcgtcgaagtggccaatggcgccggcgttcccacctccgcgctgctgacc
gacatgaatcaggtgctggcctccagcgccggtaatgcggtggaagtgcgagaggcggtg
aaattcctcacggggacccagcgtaacccgcgcctgcatcgcgtcaccctctctctgggg
gcggagttgctggtattgggtaaactggcccgtgacccggaacacgcctggcagatgctg
gaaaaaaccctctctgacggcagtgccgcagagcgctttggccgcatggtggccgggctg
ggtggaccggctgattttatggataaccccgatcgcttcctgcccaaggcaaaggtggtg
cgtccggtttatcctgaccgtaaggggatcgtcaccgccatggacacccgcgccatcggt
atggccgtggtgaacatgggcggcggccgtaaagtggccagcgattccatcgaccatagt
gtcggctttgacaatctctgcgtcctgcgccaaagcgtggatgaacaaaccccgctggcg
atgctgcacgccaatgatgacgcgcagtggcaggccggggcagatgccctgcgtaacgcc
atcaccctgggtgattcggcgcctgcggcagatccggaagtgtatcggttggttcgcgac
gcgaaccgctga

DBGET integrated database retrieval system