KEGG   Ferrimonas balearica: Fbal_2878Help
Entry
Fbal_2878         CDS       T01318                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fbl  Ferrimonas balearica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fbal_2878
   01230 Biosynthesis of amino acids
    Fbal_2878
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fbal_2878
   00051 Fructose and mannose metabolism
    Fbal_2878
   00562 Inositol phosphate metabolism
    Fbal_2878
Enzymes [BR:fbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fbal_2878
Exosome [BR:fbl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fbal_2878
  Exosomal proteins of bladder cancer cells
   Fbal_2878
  Exosomal proteins of melanoma cells
   Fbal_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3237437..3238219)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAANWKMDGSQQLANELFDKFKQLKDDSVEVVLCPPSIYLDSVQKLHEANREA
LSDCLVRLGGQNLSHHEFGAYTGEISGKMLKEFGCSYVIIGHSERRRMYGETSDIVADKF
AMAQKVGLTPILCVGESLPAREANRTFEVIAGELDAVIKKHGTLAFDNAVIAYEPLWAIG
TGKSATPEQAQEVHAYIRRRLSEVSPYIGENIRILYGGSVKASNAADLFAQPDVDGGLVG
GASLNASEFTTLCRIASEAE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccctgagacgccctatggtggctgccaactggaaaatggatggtagtcaacaactg
gcgaacgagctgttcgacaagttcaagcagcttaaggacgattccgttgaggtggtcctt
tgtccgcccagcatctacttggatagcgtgcagaagttgcacgaggccaatcgcgaagcg
ctttccgattgcctggttcgactgggtggccagaatctgagccaccacgaattcggcgcc
tataccggtgaaatctccggtaaaatgcttaaagaattcggctgcagctatgttatcatc
ggtcactccgaacgccgtcgtatgtacggagagaccagcgatatcgtggcggataaattc
gccatggcacagaaggtgggattgactccgatcctctgtgtgggggagtcccttccggct
cgcgaagcgaaccgcacctttgaggtgatcgccggagagttggacgccgtgattaagaaa
cacggtaccctggccttcgataacgcggtaattgcctatgagcctctttgggccattggt
accggtaagagcgccacccctgagcaagctcaggaagtgcacgcttacatccgtcggcgt
ttgtctgaagtgtcgccctatatcggtgagaacattcggattctctacggtggcagtgtg
aaagccagcaatgcggctgacctgtttgcccagccggatgtcgacggtggattagtcggc
ggtgcgagtttgaatgccagcgagtttactacgctgtgtcgcatcgcctcagaagcggaa
tga

DBGET integrated database retrieval system