KEGG   Ferrimonas balearica: Fbal_2922Help
Entry
Fbal_2922         CDS       T01318                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fbl  Ferrimonas balearica
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fbal_2922
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fbal_2922
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Fbal_2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3291682..3294279)
Genome map
AA seq 865 aa AA seqDB search
MRAVLPLALMVLAGCQQGSATPNTTLDQDTLNRIAEQLQVVHRVVDNRPGPHCREDKGDG
ACYRAEIELTTGDTALPATGWELRFSQVSYVQGSTGPLTIEHINGDLHRLFPGDDFAGLA
AQQTQAVPYTANFWSVSNSDPMPNYYLVAEGLEPVVIASTKEVRDPETGLWQLPFVEPLT
DPERQLRRTAEDNMAQATPRQLFSDNAALAPAESALPAAGVIPTPRQLSFTDAAPLSLQR
GYQPGGQAFSDLDAAWERLSSLGFLVARDGVPLTLQRVEGLGEEGYRLSVSGEGIELQAS
TDTGAFYALQSLSGLIRPGQDQLPALTIEDAPRYDYRGMHLDLSRNFPGHQVVYKIIDQM
AAYKLNKLHLHLADDEGWRLAIPGLPELTEIGARRCAEAEERDCLLPQLGSGVDAGAEVN
GYFSREQYIDLLRYADARHIEVIPSLDMPGHSRAAVRAMTERHRRLMAEGRTAEAGQYLL
SDLEDAPEYLSVQYYKDNTINPCLDSSYVFLGKVLDEVQAMHEAAGTPLTLYHIGADETA
GAWERSPRCEALIASELDLHDTHDLLGYFIRRVVDMLAERGIRAGGWSDGLLESKEQLAV
PVTSYSWDLLAWGGHNKAHEQLKRGWDVVLASPDALYFDFPYETDPNEGGYYWGARAINT
LKVFSLMPDNLPAHAEVWRDRQGNPYQAEDTEFALKGETIRGIQAQFWSETVRHADVVEY
KLFPRLLALAERAWHRADWELDYVPGRTFSVDSDHFTAEAERLADWQRFAALLGQQELAK
LDKAGIAYRIPTAGARIEAGKLEMNLIFPGLVLEYRVEGGEWQHYQQPVDVKGPVEVRAR
SANDQRPGRSQWLNPEQEQNGVDNK
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagtcttgcctttggcgctgatggtgctggccggatgccagcaaggaagcgcc
acgccaaacaccaccctggatcaggacactcttaaccgcattgccgaacagcttcaggtg
gtgcaccgggtggtggacaaccggccaggcccccactgccgggaagataagggcgatggc
gcctgctaccgtgctgagattgaactgaccaccggcgacaccgccctgcctgccaccggc
tgggagttgcgattcagccaggtttcctatgttcagggcagcaccggccccctcaccatc
gaacacatcaatggcgatctgcatcgcctgttccccggcgacgactttgccgggctggcc
gcgcagcagactcaggcggtgccctataccgccaacttctggagtgtgtccaactccgac
ccgatgcccaactactacctcgtcgccgaagggctggagccggtggtgatcgccagcacc
aaagaggtgcgtgacccggaaaccgggctgtggcaactgcccttcgttgagccgcttacc
gacccggagcgccagctcaggcgcaccgccgaggacaatatggcgcaggccactccgcgc
cagctgttttccgacaatgccgctctggcaccggctgagtctgccctgcctgccgctggc
gtgatccccactccccgccaactgagctttaccgacgccgcaccgctgtcactgcagcgc
ggctatcagcccggtggtcaggcgttcagtgatctggatgccgcctgggagcgcttgtcg
tcactgggttttctggtggcgcgtgatggcgtaccgctgaccctgcagcgggttgaaggg
ctgggcgaggagggctatcgcctgagtgtcagcggtgaaggcatcgaactgcaggccagc
accgataccggcgcattctatgccctgcaatccctgtccgggctgatccgccccggccag
gaccaactgccagcactgaccatcgaagacgcgccccgctacgactaccgtggcatgcat
ctggacctgtcccggaacttccccggtcaccaggtggtgtacaagatcatcgaccagatg
gcggcctacaagctcaataaactgcatctgcatctggcggacgatgagggctggcgcctg
gccattcctggcctgcctgagctgacggagattggcgcccgccgctgtgccgaagccgag
gagcgcgattgcctgttgccgcagctgggctccggtgtcgatgccggtgcggaagtgaac
ggttacttcagccgcgagcaatacatcgacctgctgcgttacgcggacgcccgccatatc
gaagtgatcccgtcgctggatatgcccggccacagccgtgctgcggttcgtgccatgaca
gagcgtcatcgccgtctgatggctgagggccgcaccgccgaggcggggcagtacctgctg
tctgatctggaagacgctcccgaatacctgtcggtgcagtattacaaagacaacaccatc
aacccctgtctcgactccagctatgtgttccttggcaaggtgctggacgaggtccaggcg
atgcacgaggcggcgggcaccccgctgaccctctaccacatcggcgccgatgaaaccgcc
ggtgcctgggagcgctccccgcgctgtgaagccctgatcgcctcagagctggacctgcac
gatacccatgacctgctcggctactttatccgccgggtggtggacatgctggctgagcgt
ggcattcgcgccggtggctggagcgacggcctgctggagtcgaaagagcagctggcggtg
ccggtgacctcctacagctgggatctgctggcctggggcggccacaacaaagcccatgag
cagctcaagcgtggctgggacgtggtgctggccagtccggacgccctctacttcgatttc
ccctacgagaccgacccgaacgagggcggctactactggggcgcgcgtgccatcaacacc
ctcaaggtgttctccctgatgccggacaaccttccggcccacgctgaggtgtggcgtgac
cgtcagggcaacccataccaggccgaagacaccgagtttgcccttaagggggaaaccatc
cgggggattcaggcgcagttctggagcgaaaccgtccgccatgccgatgtggtggagtac
aagctgttcccccgcctgctggcgctggcggagcgggcctggcaccgcgctgactgggaa
ctggactatgtgccgggtcgcaccttcagcgtcgacagcgaccactttaccgcggaagcg
gaacggctggccgactggcagcgctttgccgcgctgttggggcaacaggagctggccaag
ctcgataaggcgggcatcgcttaccgcatccccacggccggtgcccgaatcgaggccggc
aagctggagatgaacctgatcttcccgggcctggtgctggagtaccgggtggaaggcggg
gagtggcaacactatcagcaaccggttgatgtcaaagggccggtcgaagtgcgtgcccgt
tctgccaacgatcaacgccccggccgcagccagtggctgaacccggagcaggaacaaaat
ggggtggacaacaaatga

DBGET integrated database retrieval system