KEGG   Ferrimonas balearica: Fbal_3064Help
Entry
Fbal_3064         CDS       T01318                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
fbl  Ferrimonas balearica
Brite
Enzymes [BR:fbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Fbal_3064
Secretion system [BR:fbl02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Fbal_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3443056..3443793)
Genome map
AA seq 245 aa AA seqDB search
MRLPFTPLLGAMLLMVSGSSLAQTPEQTVTDALKQKLGLTADSVSEAPVAGLYEAITNQG
IFYVSADGSMLIHGQIYDLNNGMKNLTEQRMSKLRLEMLDAVKGTSIEFKAKNEKHVVYA
FTDITCGYCRKLHNEIAEYNDLGITVRYLAFPRGGERNRAGQVNQSWTDMQNVWCAKDPQ
AAMTAAKAGEKVPDVTCATGEVVKRHYELGNSMGVTGTPALVLEDGTILPGYLPPSRLLQ
ALESQ
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgagactcccctttaccccgctgctcggcgccatgttgctgatggtcagtggttccagc
ctggcccaaacgccggagcaaaccgttaccgatgccctgaagcagaagctgggcctgact
gccgacagcgtctccgaagcgccggttgccggcctgtatgaagcgatcaccaatcagggg
atcttctacgtcagtgccgatggcagcatgctgatccacggtcagatctatgacctcaac
aacggcatgaagaacctgactgagcagcgcatgagcaagctgcgcctggagatgctggac
gcggtcaaaggcacctccatcgagttcaaagccaagaacgagaagcacgtggtgtacgcg
tttaccgacatcacctgtggctactgccgtaagctgcacaacgagattgccgagtacaac
gacctgggcatcaccgtccgctacctggcgttcccccgtggcggtgagcgcaaccgtgcc
ggccaggtaaaccaatcctggaccgacatgcagaacgtttggtgtgccaaggacccgcaa
gcggccatgaccgcggccaaagcgggcgagaaggtaccggacgtcacctgtgccaccggc
gaagtggtgaagcgccactatgagctgggcaacagcatgggcgtgaccggtacgccggct
ctggtactggaagacggcaccatcctgccgggctacctgccgccgagccgcttgctccag
gccctggaaagccagtaa

DBGET integrated database retrieval system